WH0000323M1

Monoclonal Anti-APBB2 antibody produced in mouse

clone 2D8, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-FE65L, Anti-FE65L1, Anti-MGC35575, Anti-amyloid beta (A4) precursor protein-binding, family B, member 2 (Fe65-like)
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 2D8, monoclonal
• Formularz: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG1κ
• numer dostępu GenBank: BC027946
• numer dostępu UniProt: Q92870
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... APBB2(323)

Opis

Opis ogólny

The protein encoded by this gene interacts with the cytoplasmic domains of amyloid beta (A4) precursor protein and amyloid beta (A4) precursor-like protein 2. This protein contains two phosphotyrosine binding (PTB) domains, which are thought to function in signal transduction. (provided by RefSeq)

Immunogen

APBB2 (AAH27946, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKNSTPPKCRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLV

Działania biochem./fizjol.

The gene APBB2 (amyloid β precursor protein binding family B member 2), also referred to as FE65-like 1, encodes an adaptor protein that binds to the cytoplasmic domain of β-amyloid precursor protein (βAPP) and processes it to form β-amyloid (Aβ). Over-expression of APBB2 leads to an accumulation of Aβ in senile plaques seen in patients with Alzheimer′s disease (AD). Mutations in this gene have been associated with AD.

Cechy i korzyści

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)