Przejdź do zawartości
Merck

AV45607

Sigma-Aldrich

Anti-RORA antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-MGC119326, Anti-MGC119329, Anti-NR1F1, Anti-RAR-related orphan receptor A, Anti-ROR1, Anti-ROR2, Anti-ROR3, Anti-RZRA

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

62 kDa

reaktywność gatunkowa

horse, pig, rabbit, dog, goat, human, bovine

stężenie

0.5 mg - 1 mg/mL

metody

immunohistochemistry: suitable
western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... RORA(6095)

Immunogen

Synthetic peptide directed towards the middle region of human RORA

Zastosowanie

Anti-RORA antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

Działania biochem./fizjol.

Retinoic acid related orphan receptor A (RORA), a member of the retinoid-related orphan family of nuclear receptors, is a ligand-dependent transcription factor. RORA is widely expressed and enhances p53-dependent apoptosis. RORA is important for the development of the cerebellum and it is required for the maturation of photoreceptors in the retina.

Sekwencja

Synthetic peptide located within the following region: PGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDI

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Not finding the right product?  

Try our Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

David A Gold et al.
Brain research, 1140, 19-25 (2006-01-24)
The staggerer mutation was first identified at the Jackson Laboratory in 1955. In the ensuing half-century, studies of staggerer mice have provided new insights into developmental neurobiology, gene regulatory networks, and circadian behavior. Recent work has expanded the role of
Huilin Zhang et al.
Scientific reports, 4, 5811-5811 (2014-07-25)
The receptor-tyrosine-kinase-like orphan receptor 1 (ROR1) is a transmembrane protein belongs to receptor tyrosine kinase (RTK) family. This study aimed to examine the expression of ROR1 in human ovarian cancer and investigate the relationship between its expression and the prognosis

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej