AV38284

Anti-TFAP2C antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-AP2γ, Anti-ERF1, Anti-TFAP2G, Anti-Transcription factor AP-2 γ (activating enhancer binding protein 2 γ), Anti-hAP-2g
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 49 kDa
• reaktywność gatunkowa: dog, mouse, human, pig, bovine, rabbit, rat
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunohistochemistry: suitable; western blot: suitable
• numer dostępu NCBI: NP_003213
• numer dostępu UniProt: Q92754
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... TFAP2C(7022)

Opis

Opis ogólny

The AP2 family of transcription factors is expressed during mammalian development, morphogenesis and in various malignancies. Transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma) (TFAP2G, AP2gamma, ERF1, TFAP2G, AP2-gamma) is a retinoic acid-responsive gene involved in placental development and the progression of human breast cancer. AP2-gamma is required for development and maintenance of extra-embryonic membranes, trophectoderm.

Specyficzność

Anti-TFAP2C polyclonal antibody reacts with human, mouse, rat, bovine, canine, zebrafish, pig, and chicken transcription factor AP-2 gamma proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human TFAP2C

Zastosowanie

Anti-TFAP2C polyclonal antibody is used to tag transcription factor AP-2 gamma for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of transcription factor AP-2 gamma in extra-embryonic membrane development during embryo gestation.

Działania biochem./fizjol.

TFAP2C is a sequence-specific DNA-binding transcription factor involved in the activation of several developmental genes. The protein can act as either a homodimer or heterodimer with other family members and is induced during retinoic acid-mediated differentiation. It plays a role in the development of the eyes, face, body wall, limbs, and neural tube.The protein encoded by this gene is a sequence-specific DNA-binding transcription factor involved in the activation of several developmental genes. The encoded protein can act as either a homodimer or heterodimer with other family members and is induced during retinoic acid-mediated differentiation. It plays a role in the development of the eyes, face, body wall, limbs, and neural tube.

Sekwencja

Synthetic peptide located within the following region: MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTG

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable