AV49811
Anti-LENG4 antibody produced in rabbit
IgG fraction of antiserum
Sinônimo(s):
Anti-BB1
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Produtos recomendados
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
IgG fraction of antiserum
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
forma
buffered aqueous solution
peso molecular
53 kDa
reatividade de espécies
horse, dog, human, pig
concentração
0.5 mg - 1 mg/mL
técnica(s)
western blot: suitable
nº de adesão NCBI
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... LENG4(79143)
Descrição geral
Membrane bound O-acyltransferase domain containing 7 (MBOAT7; LENG4; LPLAT7) belongs to membrane-bound O-acyltransferase (MBOAT) family. The protein shows an endoplasmic reticulum-like reticular pattern and perinuclear staining in HEK293 cells.
Imunogênio
Synthetic peptide directed towards the C terminal region of human LENG4
Aplicação
Anti-LENG4 antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml. The antibody has been used for western blotting for proteins isolated from mice brain tissue.
Ações bioquímicas/fisiológicas
Membrane bound O-acyltransferase domain containing 7 (MBOAT7; LENG4) is an integral membrane protein important for reacylation of phospholipids. The reacylation is an important step in the recycling of phospholipids via the Land cycle. LENG4 is highly specific for arachidonoyl-coenzyme A and is involved in arachidonate recycling. LENG4 interacts with the small subunit of serine palmitoyltransferase a (ssSPTa). This interaction is important for LENG4-dependent incorporation of arachidonic acid into phosphatidylinositol.
Sequência
Synthetic peptide located within the following region: LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW
forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 3
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Karen E Anderson et al.
PloS one, 8(3), e58425-e58425 (2013-03-09)
We disrupted the gene encoding lysophosphatidylinositol-acyltransferase-1 (LPIAT1) in the mouse with the aim of understanding its role in determining cellular phosphoinositide content. LPIAT1(-/-) mice were born at lower than Mendelian ratios and exhibited a severe developmental brain defect. We compared
Miriam Longo et al.
Cellular and molecular gastroenterology and hepatology, 13(3), 759-788 (2021-11-26)
The I148M Patatin-like Phospholipase Domain-containing 3 (PNPLA3), the rs641738 in the Membrane bound O-acyltransferase domain containing 7-transmembrane channel-like 4 (MBOAT7-TMC4) locus, and the E167K Transmembrane 6 Superfamily Member 2 (TM6SF2) polymorphisms represent the main predisposing factors to nonalcoholic fatty liver disease
Miguel A Gijón et al.
The Journal of biological chemistry, 283(44), 30235-30245 (2008-09-06)
The cycle of deacylation and reacylation of phospholipids plays a critical role in regulating availability of arachidonic acid for eicosanoid production. The major yeast lysophospholipid acyltransferase, Ale1p, is related to mammalian membrane-bound O-acyltransferase (MBOAT) proteins. We expressed four human MBOATs
Yusuke Hirata et al.
Genes to cells : devoted to molecular & cellular mechanisms, 18(5), 397-409 (2013-03-21)
Lysophosphatidylinositol acyltransferase 1 (LPIAT1), also known as MBOAT7, is a phospholipid acyltransferase that selectively incorporates arachidonic acid (AA) into the sn-2 position of phosphatidylinositol (PI). We previously demonstrated that LPIAT1 regulates AA content in PI and plays a crucial role
Hideo Shindou et al.
Journal of lipid research, 50 Suppl, S46-S51 (2008-10-22)
Cells of all organisms are enclosed by a plasma membrane containing bipolar lipids, cholesterol, and proteins. Cellular membranes contain several classes of glycerophospholipids, which have numerous structural and functional roles in cells. Polyunsaturated fatty acids including arachidonic acid and eicosapentaenoic
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica