Pular para o conteúdo
Merck
Todas as fotos(5)

Key Documents

AMAB90627

Sigma-Aldrich

Monoclonal Anti-HER2 antibody produced in mouse

Prestige Antibodies® Powered by Atlas Antibodies, clone CL0268, purified immunoglobulin, buffered aqueous glycerol solution

Sinônimo(s):

Anti Her2 Antibody, Anti Her2 Antibody - Monoclonal Anti-HER2 antibody produced in mouse, CD340, HER-2, HER2, NEU, NGL

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

CL0268, monoclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

forma

buffered aqueous glycerol solution

reatividade de espécies

human

técnica(s)

immunoblotting: 1 μg/mL
immunohistochemistry: 1:50- 1:200

Isotipo

IgG1

Ensembl | Número de adesão de ser humano

aplicação(ões)

research pathology

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... HER2(2064)

Descrição geral

Human epidermal growth factor receptor 2 (HER2), also known as Erb-b2 receptor tyrosine kinase 2 (ErbB2), is encoded by the gene mapped to human chromosome 17. The encoded protein is a member of epidermal growth factor family. HER2 membrane protein is characterized with a cysteine-rich extracellular ligand-binding domain, a hydrophobic membrane spanning region and an intracellular tyrosine kinase domain.This protein does not have a ligand., It either forms heterodimers with other family members or homodimer with itself, when expressed at very high levels, to get activated. HER2 is expressed at low level in normal tissues, but at high level in breast cancer tissues.

Imunogênio

V-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian) recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Monoclonal Anti-HER2 antibody produced in mouse has been used in Western blotting.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Ações bioquímicas/fisiológicas

Human epidermal growth factor receptor 2 (HER2) signaling pathway promotes cell proliferation and survival in majority of breast cancers. Thus, overexpression of this protein leads to breast cancer. Heterodimeric complex of HER2 and phosphatidylinositide 3-kinase (PI3K) is the most potent stimulator of the phosphatidylinositol-3-kinase (PI3K)/Akt anti-apoptosis pathway. Upregulated expression of HER2 is associated with the development of ovarian, colorectal, pancreatic, endometrial and gastric cancers. Trastuzumab, an antibody, works by binding to a domain in the external domain of HER2. This domain is missing in p95, a truncated form of HER2, and hence these cancer cells show resistance to trastuzumab. HER2 protein can be used as a prognostic marker and as a therapeutic option for gynecologic cancers.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Sequência

YNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFGAPHR

Ligação

Corresponding Antigen APREST93786

forma física

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1


Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Christiane Stiller et al.
Bioconjugate chemistry, 30(11), 2790-2798 (2019-10-15)
Antibody-DNA conjugates are powerful tools for DNA-assisted protein analysis. Growing usage of these methods demands efficient production of high-quality conjugates. We developed an easy and fast synthesis route yielding covalent antibody-DNA conjugates with a defined conjugation site and low batch-to-batch
Inga Newie et al.
Scientific reports, 6, 35664-35664 (2016-10-19)
We previously reported that the human HER2 gene encodes the intronic microRNA mir-4728, which is overexpressed together with its oncogenic host gene and may act independently of the HER2 receptor. More recently, we also reported that the oncogenic miR-21-5p is
HER2 expression beyond breast cancer: therapeutic implications for gynecologic malignancies.
English DP, et al.
Molecular Diagnosis & Therapy, 17(2), 85-99 (2013)
The role of p95HER2 in trastuzumab resistance in breast cancer.
Ozkavruk Eliyatkin N, et al.
Journal of B.U.ON. : Official Journal of the Balkan Union of Oncology, 21(2), 382-389 (2016)
HER2: biology, detection, and clinical implications.
Gutierrez C and Schiff R.
Archives of Pathology & Laboratory Medicine, 135(1), 55-62 (2011)

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica