Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

AV48038

Sigma-Aldrich

Anti-STRAP (AB1) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-MAWD, Anti-PT-WD, Anti-Serine/threonine kinase receptor associated protein, Anti-UNRIP

Sign Into View Organizational & Contract Pricing
All Photos(2)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

38 kDa

species reactivity

rabbit, guinea pig, horse, rat, dog, human, mouse, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

NP_009109

UniProt accession no.

Q9Y3F4

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... STRAP(11171)

General description

Serine/threonine kinase receptor associated protein (STRAP) is a poly(A) RNA binding protein that modulates type I collagen mRNA translation. It decreases the ubiquitination of Notch3 and negatively regulates ASK1.
Rabbit Anti-STRAP antibody recognizes human, mouse, rat, canine, bovine, and zebrafish STRAP.

Immunogen

Synthetic peptide directed towards the N terminal region of human STRAP

Application

Rabbit Anti-STRAP antibody is suitable for IHC applications at a dilution of 1:150 and for western blot applications at a concentration of 0.5μg/ml.

Biochem/physiol Actions

The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex.

Sequence

Synthetic peptide located within the following region: HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Isam B Sharum et al.
Reproduction (Cambridge, England), 153(2), 221-231 (2016-11-24)
The molecular mechanisms involved in regulating the development of small, gonadotrophin-independent follicles are poorly understood; however, many studies have highlighted an essential role for TGFB ligands. Canonical TGFB signalling is dependent upon intracellular SMAD proteins that regulate transcription. STRAP has
Wei Liu et al.
Synapse (New York, N.Y.), 68(6), 275-282 (2014-03-01)
Recent studies have shown that transforming growth factor β (TGFβ) signaling participates in the epileptogenesis. Serine-threonine kinase receptor-associated protein (STRAP) and Smad7 synergize in the inhibition of the TGFβ signaling. The aim of the present study was to determine the
Milica Vukmirovic et al.
Molecular and cellular biology, 33(19), 3893-3906 (2013-08-07)
Type I collagen is the most abundant protein in the human body and is composed of two α1(I) and one α2(I) polypeptides which assemble into a triple helix. For the proper assembly of the collagen triple helix, the individual polypeptides
Haiyoung Jung et al.
The Journal of biological chemistry, 285(1), 54-70 (2009-11-03)
Serine-threonine kinase receptor-associated protein (STRAP) interacts with transforming growth factor beta (TGF-beta) receptors and inhibits TGF-beta signaling. Here, we identify STRAP as an interacting partner of ASK1 (apoptosis signal-regulating kinase 1). The association between ASK1 and STRAP is mediated through
Nilesh D Kashikar et al.
Cell cycle (Georgetown, Tex.), 10(10), 1639-1654 (2011-04-20)
Glycogen synthase kinase 3β (GSK3β) can regulate a broad range of cellular processes in a variety of cell types and tissues through its ability to phosphorylate its substrates in a cell- and time-specific manner. Although it is known that Axin

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service