SAB5702248

Anti-Folate Binding Protein(FBP) / FOLR1 Antibody, clone 3J6W3, Rabbit Monoclonal

• Synonim(y): FOLR1,FBP,FOLR
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• Materiały: colorless
• klon: 3J6W3, monoclonal
• Postać: liquid
• masa cząsteczkowa: 38 kDa
• reaktywność gatunkowa: human, rat, rat
• stężenie: 0.93 mg/mL
• metody: western blot: 1:500 - 1:1000
• kolor: colorless
• izotyp: IgG
• sekwencja immunogenna: MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHF
• numer dostępu UniProt: P15328
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... FOLR1(2348)

Opis

Opis ogólny

The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. Mutations in this gene have been associated with neurodegeneration due to cerebral folate transport deficiency. Due to the presence of two promoters, multiple transcription start sites, and alternative splicing, multiple transcript variants encoding the same protein have been found for this gene.

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Folate Binding Protein(FBP) / FOLR1 (NP_000793.1).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Zastosowanie

WB

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Piktogramy: GHS07,GHS09
• Hasło ostrzegawcze: Warning
• Zwroty wskazujące rodzaj zagrożenia: H317,H411
• Zwroty wskazujące środki ostrożności: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Klasyfikacja zagrożeń: Aquatic Chronic 2 - Skin Sens. 1
• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3