SAB5702155

Anti-NeuN Antibody, clone 3M5M9, Rabbit Monoclonal

• Synonim(y): FOX-3,FOX3,HRNBP3,NEUN,NeuN,RBFOX3
• Kod UNSPSC: 12352203
• NACRES: NA.46
• klon: 3M5M9, monoclonal
• application: IF; IHC; WB
• reaktywność gatunkowa: rat, rat, human
• metody: immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:1000

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• Materiały: colorless
• klon: 3M5M9, monoclonal
• Formularz: liquid
• masa cząsteczkowa: 46-55 kDa
• reaktywność gatunkowa: rat, rat, human
• stężenie: 1.00 mg/mL
• metody: immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:1000
• kolor: colorless
• izotyp: IgG
• sekwencja immunogenna: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR
• numer dostępu UniProt: A6NFN3
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... RBFOX3(146713)

Opis

Opis ogólny

This gene encodes a member of the RNA-binding FOX protein family which is involved in the regulation of alternative splicing of pre-mRNA. The protein has an N-terminal proline-rich region, an RNA recognition motif (RRM) domain, and a C-terminal alanine-rich region. This gene produces the neuronal nuclei (NeuN) antigen that has been widely used as a marker for post-mitotic neurons. This gene has its highest expression in the central nervous system and plays a prominent role in neural tissue development and regulation of adult brain function. Mutations in this gene have been associated with numerous neurological disorders. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NeuN (A6NFN3).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Zastosowanie

WB, IHC, IF/ICC

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Piktogramy: GHS07,GHS09
• Hasło ostrzegawcze: Warning
• Zwroty wskazujące rodzaj zagrożenia: H317,H411
• Zwroty wskazujące środki ostrożności: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Klasyfikacja zagrożeń: Aquatic Chronic 2 - Skin Sens. 1
• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3