SAB1410940
Anti-IL23A antibody produced in rabbit
purified immunoglobulin, buffered aqueous solution
Synonim(y):
IL-23, IL-23A, IL23P19, MGC79388, P19, SGRF
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Kod UNSPSC:
12352203
NACRES:
NA.41
Polecane produkty
pochodzenie biologiczne
rabbit
białko sprzężone
unconjugated
forma przeciwciała
purified immunoglobulin
rodzaj przeciwciała
primary antibodies
klon
polyclonal
Postać
buffered aqueous solution
masa cząsteczkowa
antigen 20.7 kDa
reaktywność gatunkowa
human
metody
western blot: 1 μg/mL
numer dostępu NCBI
numer dostępu UniProt
Warunki transportu
dry ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... IL23A(51561)
Opis ogólny
Interleukin 23 subunit α (IL23A) gene with 4 exons, spanning 1531bp of genomic DNA, is mapped to human chromosome 12q13.2. The gene codes for a 19kDa cytokine, p19. The protein consists of a signal peptide and mature peptide composed of four α helices.
This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the β1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-γ(IFNG). In contrast to IL12, which acts mainly on naive CD4+ T cells, IL23 preferentially acts on memory CD4+ T cells. (provided by RefSeq)
Immunogen
IL23A (NP_057668.1, 1 a.a. ~ 189 a.a) full-length human protein.
Sequence
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Sequence
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Działania biochem./fizjol.
Interleukin 23 subunit α (IL23A) plays a vital role downstream of the Janus kinase/signal transducers and activators of transcription (JAK/STAT) pathway, that transduces signals for cell proliferation, differentiation, cell migration and apoptosis. Elevated expression of IL23A has been observed in meibomian cell carcinoma (MCC). Mutation in the gene increases the risk of susceptibility to psoriatic arthritis (PsA) as well as psoriasis.
Postać fizyczna
Solution in phosphate buffered saline, pH 7.4
This page may contain text that has been machine translated.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 3
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Certyfikaty analizy (CoA)
Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
IL23A (interleukin 23, alpha subunit p19)
Norimitsu Inoue
Atlas of Genetics and Cytogenetics in Oncology and Haematology, 1-4 (2010)
John Bowes et al.
Annals of the rheumatic diseases, 70(9), 1641-1644 (2011-05-31)
To investigate a shared genetic aetiology for skin involvement in psoriasis and psoriatic arthritis (PsA) by genotyping single-nucleotide polymorphisms (SNPs), reported to be associated in genome-wide association studies of psoriasis, in patients with PsA. SNPs with reported evidence for association
Arun Kumar et al.
Genomics, 90(5), 559-566 (2007-09-25)
Meibomian cell carcinoma (MCC) is a malignant tumor of the meibomian glands located in the eyelids. No information exists on the cytogenetic and genetic aspects of MCC. There is no report on the gene expression profile of MCC. Thus there
J Niu et al.
Clinical and experimental immunology, 176(3), 473-484 (2014-02-18)
Hepatic allograft rejection remains a challenging problem, with acute rejection episode as the major barrier for long-term survival in liver transplant recipients. To explore a strategy to prevent allograft rejection, we hypothesized that mesenchymal stem cells (MSCs) genetically engineered with
María Florencia Ogara et al.
Biochimica et biophysica acta, 1843(7), 1309-1324 (2014-04-08)
DNA damage, which perturbs genomic stability, has been linked to cognitive decline in the aging human brain, and mutations in DNA repair genes have neurological implications. Several studies have suggested that DNA damage is also increased in brain disorders such
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej