SAB1402393

Monoclonal Anti-WNT5A antibody produced in mouse

clone 3A4, purified immunoglobulin, buffered aqueous solution

• Synonim(y): hWNT5A
• Numer MDL: MFCD07784920
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 3A4, monoclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen ~37.11 kDa
• reaktywność gatunkowa: human
• metody: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable
• izotyp: IgG2aκ
• numer dostępu NCBI: BC064694
• numer dostępu UniProt: P41221
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... WNT5A(7474)

Opis

Opis ogólny

Wnt family member 5A (WNT5A) is a secreted, proinflammatory protein. It is part of the noncanonical WNT family. The gene encoding this protein is localized on human chromosome 3p14.3.

Immunogen

WNT5A (AAH64694, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV

Działania biochem./fizjol.

Wnt family member 5A (WNT5A) has a role in metabolic dysfunction in obesity and negatively modulates angiogenesis in adipose tissue. The protein regulates cell motility and polarity by activating β-catenin–independent pathways. It has been shown to be overexpressed in gliomas.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable