Przejdź do zawartości
Merck
Wszystkie zdjęcia(3)

Key Documents

AV51755

Sigma-Aldrich

Anti-SEPT9 antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-AF17q25, Anti-KIAA0991, Anti-MSF, Anti-MSF1, Anti-NAPB, Anti-PNUTL4, Anti-SINT1, Anti-Septin 9

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(3)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

37 kDa

reaktywność gatunkowa

human, rat, guinea pig, mouse

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_006631

numer dostępu UniProt

Q9UHD8

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... SEPT9(septin 9)

Powiązane kategorie

Immunogen

Synthetic peptide directed towards the C terminal region of human SEPT9(septin 9)

Zastosowanie

Anti-SEPT9 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.

Działania biochem./fizjol.

Septin 9 (SEPT9; SeptD1) is a member of the septin family and is involved in cell cycle control and cytokinesis. Members of this family form complexes and filamentous structures that maintain the cytoskeleton. The septin proteins act as scaffolds to recruit proteins to specific cellular locations. Septin 9 interacts with bundle microtubules and is altered in neuralgic amyotrophy. It has been found to be hypermethylated in certain cancers.

Sekwencja

Synthetic peptide located within the following region: HCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEK

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Septins.
Mathew P Estey et al.
Current biology : CB, 21(10), R384-R387 (2011-05-24)
Reinhold Wasserkort et al.
BMC cancer, 13, 398-398 (2013-08-31)
The septin 9 gene (SEPT9) codes for a GTP-binding protein associated with filamentous structures and cytoskeleton formation. SEPT9 plays a role in multiple cancers as either an oncogene or a tumor suppressor gene. Regulation of SEPT9 expression is complex and
Xiaobo Bai et al.
The Journal of cell biology, 203(6), 895-905 (2013-12-18)
Septin 9 (SEPT9) interacts with microtubules (MTs) and is mutated in hereditary neuralgic amyotrophy (HNA), an autosomal-dominant neuropathy. The mechanism of SEPT9 interaction with MTs and the molecular basis of HNA are unknown. Here, we show that the N-terminal domain
Kirstin Sandrock et al.
Biological chemistry, 392(8-9), 751-761 (2011-07-20)
Septins constitute a group of GTP binding proteins that assemble into homo- and hetero-oligomeric complexes and filaments. These higher order septin structures are thought to function like scaffolds and/or diffusion barriers serving as spatial localizers for many proteins with key

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej