AV46227

Anti-NCAPH antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-BRRN1, Anti-CAP-H, Anti-HCAP-H, Anti-Non-SMC condensin I complex, subunit H
• Kod UNSPSC: 12352203
• NACRES: NA.41
• białko sprzężone: unconjugated
• application: WB
• klon: polyclonal
• reaktywność gatunkowa: dog, human, mouse, rabbit, rat, pig
• citations: 2
• metody: western blot: suitable

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Formularz: buffered aqueous solution
• masa cząsteczkowa: 82 kDa
• reaktywność gatunkowa: dog, human, mouse, rabbit, rat, pig
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_056156
• numer dostępu UniProt: Q15003
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... NCAPH(23397)

Opis

Immunogen

Synthetic peptide directed towards the C terminal region of human NCAPH

Zastosowanie

Anti-NCAPH antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

Działania biochem./fizjol.

NCAPH (Non-SMC condensin I complex, subunit H) also referred to as HCAP-H, BRRN1 or CAPH belongs to barr gene family and is a regulatory subunit of the condensin complex. It facilitates the conversion of interphase chromatin into mitotic-like condense chromosomes. Caspase-3 gets stimulated and cleaves Cap-H, a subunit of condensin I during prolonged mitotic arrest. This leads to a loss of condensin I complex at the chromosomes and alters the chromosomal integrity. Subsequently DNA fragmentation occurs by caspase-activated Dnase (CAD) that drives the cell towards mitotic death. Additionally, it facilitates for the structural integrity of centromeric heterochromatin during mitosis.

Sekwencja

Synthetic peptide located within the following region: TKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable