Przejdź do zawartości
Merck
Wszystkie zdjęcia(4)

Kluczowe dokumenty

AV31655

Sigma-Aldrich

Anti-ESRRG antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-Estrogen-related receptor γ

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(4)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Formularz

buffered aqueous solution

masa cząsteczkowa

51 kDa

reaktywność gatunkowa

human, rabbit, dog, guinea pig, horse, mouse, bovine, rat

stężenie

0.5 mg - 1 mg/mL

metody

immunohistochemistry: suitable
western blot: suitable

numer dostępu NCBI

NP_001127757

numer dostępu UniProt

P62508

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... ESRRG(2104)

Opis ogólny

ESRRG (or ERRgamma) is a transcriptional activator of Dnmt1 expression in humans and mice. This transcription factor has also been implicated in renal papilla development, as well as in lipid and lipoprotein metabolism.
Rabbit ESRRG antibody recognizes bovine, human, mouse, rat, zebrafish, canine, and chicken ESRRG.

Immunogen

Synthetic peptide directed towards the middle region of human ESRRG

Zastosowanie

Rabbit ESRRG antibody has been used for co-immunoprecipitation and western blot assays. Sigma has verified the use of the product in western blot (0.5μg/ml) and immunohistochemistry (4-8μg/ml, using paraffin-embedded tissue sections) applications.

Działania biochem./fizjol.

ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells. Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis. Transcriptional activation by ERR3 can be ligand-independent.

Sekwencja

Synthetic peptide located within the following region: RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number
QC1190

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Wyszukaj dokument COA

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

D Sanoudou et al.
The pharmacogenomics journal, 10(3), 165-179 (2009-12-02)
We have used a new ApoA-I transgenic mouse model to identify by global gene expression profiling, candidate genes that affect lipid and lipoprotein metabolism in response to fenofibrate treatment. Multilevel bioinformatical analysis and stringent selection criteria (2-fold change, 0% false
Yuxia Zhang et al.
FEBS letters, 585(9), 1269-1275 (2011-04-05)
We describe a transcriptional mechanism regulating the expression of Dnmt1 by nuclear receptors. We show that ERRγ functions as a transcriptional activator of mouse and human Dnmt1 expression by direct binding to its response elements (ERE1/ERE2) in the dnmt1/DNMT1 promoters.
Rachel Berry et al.
Human molecular genetics, 20(5), 917-926 (2010-12-09)
Congenital anomalies of the kidney and urinary tract (CAKUTs) are common disorders of human development affecting the renal parechyma, renal pelvis, ureter, bladder and urethra; they show evidence of shared genetic aetiology, although the molecular basis of this remains unknown

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej