AV31947

Anti-HNF4G (AB1) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-Hepatocyte Nuclear factor 4, γ
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 46 kDa
• reaktywność gatunkowa: dog, rabbit, rat, human, guinea pig
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_004124
• numer dostępu UniProt: Q14541
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... HNF4G(3174)

Opis

Opis ogólny

HNF4G is a nuclear receptor that regulates hyaluronan synthase 2 (HAS2) and facilitates the metastasis of bladder cancer.
Rabbit Anti-HNF4G recognizes chicken, mouse, canine, bovine, human, and rat HNF4G.

The previously assigned protein identifier Q7Z2V9 has been merged into Q14541. Full details can be found on the UniProt database.

Immunogen

Synthetic peptide directed towards the C terminal region of human HNF4G

Zastosowanie

Rabbit Anti-HNF4G (AB1) antibody can be used for western blot applications at concentration of 1.0μg/ml.

Działania biochem./fizjol.

HNF4 was first identified as a DNA binding activity in rat liver nuclear extracts and then was found to be an orphan member of the nuclear receptor superfamily. Binding sites for this factor were identified in many tissue-specifically expressed genes, and the protein was found to be essential for early embryonic development in the mouse

Sekwencja

Synthetic peptide located within the following region: MSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable