Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

SAB2107115

Sigma-Aldrich

Anti-KRAS antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-C-K-RAS, Anti-CFC2, Anti-K-RAS2A, Anti-K-RAS2B, Anti-K-RAS4A, Anti-K-RAS4B, Anti-K-Ras, Anti-K-Ras 2, Anti-KRAS1, Anti-KRAS2, Anti-NS, Anti-NS3, Anti-OES, Anti-RALD, Anti-RASK2, Anti-c-Ki-ras, Anti-c-Ki-ras2

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

20 kDa

reatividade de espécies

human, rabbit, bovine, rat, guinea pig, horse, dog, mouse

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... KRAS(3845)
rat ... Kras(24525)

Imunogênio

The immunogen for anti-KRAS antibody: synthetic peptide derected towards the N terminal of human KRAS

Ações bioquímicas/fisiológicas

Kras is a oncogene and member of the small GTPase superfamily.

Sequência

Synthetic peptide located within the following region: QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVP

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Wulamujiang Aini et al.
Transplant immunology, 31(2), 55-59 (2014-07-06)
In living donor liver transplantation, the biological organ age of the donated allograft is unknown in young patients who receive grafts from older donors. Few studies have focused on the effects of aging on allografts in the state of tolerance.
Hua Yang et al.
Anti-cancer drugs, 25(7), 767-777 (2014-04-02)
Histone deacetylase inhibitors are a new class of anticancer agents that inhibit cancer cell proliferation and induce apoptosis and cell cycle arrest in various cancer cells. Recently, we identified ZYJ-34c, a modified histone deacetylase inhibitor that showed significantly higher antitumor
Maria Angelica Cortez et al.
Molecular therapy : the journal of the American Society of Gene Therapy, 22(8), 1494-1503 (2014-05-06)
The microRNA (miR)-200s and their negative regulator ZEB1 have been extensively studied in the context of the epithelial-mesenchymal transition. Loss of miR-200s has been shown to enhance cancer aggressiveness and metastasis, whereas replacement of miR-200 miRNAs has been shown to
Ki Hwan Kweon et al.
International journal of oncology, 45(5), 2065-2075 (2014-08-12)
Despite the favorable therapeutic outcomes reported in differentiated thyroid cancer (DTC), a significant proportion of DTC patients present with refractory behavior to conventional therapy. The sirtuin (Sirt) family has recently been implicated in the maintenance of cellular homeostasis under genotoxic
Joseph Carver et al.
PloS one, 9(8), e103836-e103836 (2014-08-06)
Mutations in the Ras family of small GTPases, particularly KRAS, occur at high frequencies in cancer and represent a major unmet therapeutic need due to the lack of effective targeted therapies. Past efforts directed at inhibiting the activity of the

Global Trade Item Number

SKUGTIN
SAB2107115-100UL4061836113896
SAB2107115-50UG

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica