Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

MSST0038

Sigma-Aldrich

SILuLite IGFBP7 Insulin-like growth factor-binding protein 7 human

recombinant, expressed in HEK 293 cells, MS Protein Standard

Sinônimo(s):

IBP-7, IGF-binding protein 7, IGF-bindingprotein7, IGFBP-7, IGFBP-rP1, MAC25 protein, PGI2-stimulating factor, Prostacyclin-stimulating factor, Tumor-derived adhesion factor (TAF)

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
23201100
NACRES:
NA.12

fonte biológica

human

Nível de qualidade

recombinante

expressed in HEK 293 cells

Ensaio

≥98% (SDS-PAGE)

Formulário

lyophilized powder

potência

≥98 Heavy amino acids incorporation efficiency by MS

técnica(s)

mass spectrometry (MS): suitable

adequação

suitable for mass spectrometry (internal calibrator)

nº de adesão UniProt

temperatura de armazenamento

−20°C

Informações sobre genes

human ... IGFBP7(3490)

Descrição geral

IGFBP7 (insulin-like growth factor-binding protein 7) belongs to the IGFBP superfamily and is widely expressed in tissues. It contains 11 cysteines, a heparin binding site, a kazal-type trypsin inhibitor domain and a carboxyl-terminal immunoglobulin-like type C repeat. IGFBP7 binds weakly to IGFs (insulin like growth factors) and strongly to insulin. It mainly participates in IGF-independent pathways. The IGFBP7 gene is mapped to human chromosome 4q12.
SILu Lite IGFBP7 is a recombinant human protein expressed in human 293 cells. It is a protein consisting of 267 amino acids (including an N-terminal polyhistidine tag), with a calculated molecular mass of 28 kDa. SILu Lite IGFBP7 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Imunogênio

HHHHHHHHGGQSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Ações bioquímicas/fisiológicas

IGFBP7 (insulin-like growth factor-binding protein 7) acts as a tumor suppressor as well as an oncogene by controlling cell proliferation, cell attachment, apoptosis and angiogenesis. It is also involved in TGFβ (transforming growth factor beta) signal pathway. IGFBP7 interferes with the insulin pathway and is associated with the development of diabetes as well as cardiovascular diseases.
SILuLite IGFBP7 is a recombinant human protein expressed in human 293 cells. It is a protein consisting of 267 amino acids (including an N-terminal polyhistidine tag), with a calculated molecular mass of 28 kDa. SILu Lite IGFBP7 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

forma física

Supplied as a lyophilized powder containing phosphate buffered saline.

Informações legais

SILu is a trademark of Sigma-Aldrich Co. LLC

Código de classe de armazenamento

11 - Combustible Solids

Classe de risco de água (WGK)

WGK 2

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Methylation status of insulin-like growth factor-binding protein 7 concurs with the malignance of oral tongue cancer.
Chen L H, et al.
Journal of Experimental & Clinical Cancer Research, 34(1), 20-20 (2015)
Yi Liu et al.
Scientific reports, 5, 10227-10227 (2015-05-20)
Metabolic syndrome (MetS), one of the major public health concerns, is regarded as the "common soil" of incidence of common chronic diseases and may increase the risk of type 2 diabetes. The predominant underlying mechanism of MetS is insulin resistance
Overexpressed Skp2 within 5p amplification detected by array?based comparative genomic hybridization is associated with poor prognosis of glioblastomas
Saigusa K, et al.
Cancer Science, 96(10), 676-683 (2005)

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica