MSST0015

SILu^™Prot B2M beta-2-microglobulin human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, ¹³C- and ¹⁵N-labeled

• Sinônimo(s): β-2-microglobulin
• Código UNSPSC: 23201100
• NACRES: NA.12

Propriedades

• fonte biológica: human
• Nível de qualidade: 200
• recombinante: expressed in HEK 293 cells
• Ensaio: ≥98% (SDS-PAGE)
• Formulário: lyophilized powder
• potência: ≥98% Heavy amino acids incorporation efficiency by MS
• técnica(s): mass spectrometry (MS): suitable
• adequação: suitable for mass spectrometry (standard)
• nº de adesão UniProt: P61769
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... B2M(567)

Descrição

Descrição geral

SILu^™ Prot B2M is a recombinant, stable isotope-labeled human B2M which incorporates [¹³C₆, ¹⁵N₄]-Arginine and [¹³C₆, ¹⁵N₂]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of B2M in mass-spectrometry. SILu^™ Prot B2M is a monomer of 119 amino acids (including C-terminal polyhistidine and flag tags), with a molecular weight of ~14 kDa.
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Ações bioquímicas/fisiológicas

B2M is the light chain of the major histocompatibility class (MHC) I molecule expressed on the cell surface of all nucleated cells. Increased urinary B2M excretion has been observed to be an early marker of tubular injury in a number of settings, including nephrotoxicant exposure, cardiac surgery, and renal transplantation, preceding rises in serum creatinine by as many as 4−5 days. B2M may also serve as an early biomarker for AKI (Acute Kidney Injury).

Sequência

IQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMDYKDDDDKGHHHHHHHHGGQ

forma física

Supplied as a lyophilized powder containing phosphate buffered saline.

Informações legais

SILu is a trademark of Sigma-Aldrich Co. LLC

Informações de segurança

• Código de classe de armazenamento: 11 - Combustible Solids
• Classe de risco de água (WGK): WGK 2
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable