MSST0016

SILu^™Lite B2M beta-2-microglobulin human

recombinant, expressed in HEK 293 cells, MS Protein Standard

• Sinônimo(s): β-2-microglobulin, Mass spectrometry standard, B@M, Mass spectrometry standard, beta-2-microglobulin
• Código UNSPSC: 23201100
• NACRES: NA.12

Propriedades

• fonte biológica: human
• Nível de qualidade: 200
• recombinante: expressed in HEK 293 cells
• Ensaio: ≥98% (SDS-PAGE)
• forma: lyophilized powder
• técnica(s): mass spectrometry (MS): suitable
• adequação: suitable for mass spectrometry (internal calibrator)
• nº de adesão UniProt: P61769
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... B2M(567)

Descrição

Descrição geral

SILu^™ Lite B2M is a recombinant human protein expressed in human 293 cells. It is a monomer of 119 amino acids (including C-terminal polyhistidine and flag tags), with a molecular weight of ~14 kDa. SILu^™ Lite B2M is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Ações bioquímicas/fisiológicas

B2M is the light chain of the major histocompatibility class (MHC) I molecule expressed on the cell surface of all nucleated cells. Increased urinary B2M excretion has been observed to be an early marker of tubular injury in a number of settings, including nephrotoxicant exposure, cardiac surgery, and renal transplantation, preceding rises in serum creatinine by as many as 4−5 days. B2M may also serve as an early biomarker for AKI (Acute Kidney Injury).

Sequência

IQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMDYKDDDDKGHHHHHHHHGGQ

forma física

Supplied as a lyophilized powder containing phosphate buffered saline.

Informações legais

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

Informações de segurança

• Código de classe de armazenamento: 11 - Combustible Solids
• Classe de risco de água (WGK): WGK 2
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable