HPA002823
Anti-TM4SF1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinônimo(s):
Anti-M3S1 antibody produced in rabbit, Anti-Membrane component surface marker 1 antibody produced in rabbit, Anti-Transmembrane 4 L6 family member 1 antibody produced in rabbit, Anti-Tumor-associated antigen L6 antibody produced in rabbit
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
Produtos recomendados
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
linha de produto
Prestige Antibodies® Powered by Atlas Antibodies
forma
buffered aqueous glycerol solution
reatividade de espécies
human
técnica(s)
immunohistochemistry: 1:500- 1:1000
sequência de imunogênio
GPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVSLFSI
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... TM4SF1(4071)
Categorias relacionadas
Imunogênio
Transmembrane 4 L6 family member 1 recombinant protein epitope signature tag (PrEST)
Aplicação
Anti-TM4SF1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Ações bioquímicas/fisiológicas
Transmembrane 4 L6 family member 1 is a protein encoded by the TM4SF1 gene in humans. It is a cell surface antigen, which is highly expressed in lung, breast, colon and ovarian carcinomas. It has a novel function in Androgen Receptor (AR) signaling. Its mRNA expression is higher in prostate cancer tissues as compared to benign prostatic hyperplasia (BPH). It is found to contribute to prostate cancer cell metastasis. The gene serves as a molecular organizer that interacts with membrane and cytoskeleton-associated proteins. It uniquely initiates the formation of nanopodia and facilitates cell polarization and migration. It also regulates tumour cell motility and invasiveness. It is abundant on the plasma membrane and on intracellular vesicles.
Características e benefícios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligação
Corresponding Antigen APREST85203
forma física
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informações legais
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 1
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Equipamento de proteção individual
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Nathalie Allioli et al.
The Prostate, 71(11), 1239-1250 (2011-06-10)
The Androgen Receptor (AR) plays a key role in controlling prostate gland homeostasis and contributes to prostate carcinogenesis. The identification of its target genes should provide new candidates that may be implicated in cancer initiation and progression. Transcriptomic experiments and
J S Marken et al.
Proceedings of the National Academy of Sciences of the United States of America, 89(8), 3503-3507 (1992-04-15)
The L6 cell surface antigen, which is highly expressed on lung, breast, colon, and ovarian carcinomas, has attracted attention as a therapeutic target for murine monoclonal antibodies and their humanized counterparts. Its molecular nature has, however, remained elusive. Here we
TM4SF1: a tetraspanin-like protein necessary for nanopodia formation and endothelial cell migration.
Andrew Zukauskas et al.
Angiogenesis, 14(3), 345-354 (2011-06-01)
Transmembrane-4-L-six-family-1 (TM4SF1) is a tetraspanin-like membrane protein that is highly and selectively expressed by cultured endothelial cells (EC) and, in vivo, by EC lining angiogenic tumor blood vessels. TM4SF1 is necessary for the formation of unusually long (up to a
Tamara Lekishvili et al.
Journal of cell science, 121(Pt 5), 685-694 (2008-02-14)
Tumour-associated antigen L6 (L6-Ag, also known as TM4SF1) regulates tumour cell motility and invasiveness. We found that L6-Ag is abundant on the plasma membrane and on intracellular vesicles, on which it is co-localised with the markers for late endosomal/lysosomal compartments
Chi-Iou Lin et al.
Angiogenesis, 17(4), 897-907 (2014-07-06)
Transmembrane-4 L-six family member-1 (TM4SF1) is a small plasma membrane glycoprotein that regulates cell motility and proliferation. TM4SF1 is an attractive cancer target because of its high expression in both tumor cells and on the vascular endothelial cells lining tumor
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica