Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

SAB2100822

Sigma-Aldrich

Anti-FLI1 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-EWSR2, Anti-Friend leukemia virus integration 1, Anti-SIC-1

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(2)

About This Item

Número MDL:
MFCD01864665
Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

51 kDa

reatividade de espécies

dog, human, rabbit, guinea pig, bovine

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão UniProt

Q01543

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... FLI1(2313)

Categorias relacionadas

Descrição geral

Fli-1 proto-oncogene, ETS transcription factor (FLI1) is encoded by the gene mapped to human chromosome 11. The encoded protein belongs to the ETS family of transcription factors. FLI1 consists of ETS DNA-binding domain at its C-terminal end and is mainly expressed in hematopoietic and vascular endothelial cells.

Imunogênio

Synthetic peptide directed towards the middle region of human FLI1

Aplicação

Anti-FLI1 antibody produced in rabbit has been used in chromatin immunoprecipitation.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.Chromatin immunoprecipitation (1 paper)
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Chromatin immunoprecipitation (1 paper)

Ações bioquímicas/fisiológicas

Fli-1 proto-oncogene, ETS transcription factor (FLI1) acts as a sequence-specific transcriptional activator. It might be implicated in the development of both the haematopoietic and vascular systems. In addition, it also plays a vital role in megakaryopoiesis and platelet function. FLI1 functions as a regulator of essential midkine (MK) genes. Mutations in FLI1 is associated with the pathogenesis of Paris-Trousseau syndrome and congenital thrombocytopenia.

Sequência

Synthetic peptide located within the following region: FDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMP

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC7886

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

The Fli-1 proto-oncogene, involved in erythroleukemia and Ewing's sarcoma, encodes a transcriptional activator with DNA-binding specificities distinct from other Ets family members.
Zhang L
Oncogene, 8(6), 1621-1630 (1993)
Marco Fidaleo et al.
Oncotarget, 6(31), 31740-31757 (2015-10-10)
Alternative splicing plays a key role in the DNA damage response and in cancer. Ewing Sarcomas (ES) are aggressive tumors caused by different chromosomal translocations that yield in-frame fusion proteins driving transformation. RNA profiling reveals genes differentially regulated by UV
EWS, but not EWS-FLI-1, is associated with both TFIID and RNA polymerase II: interactions between two members of the TET family, EWS and hTAFII68, and subunits of TFIID and RNA polymerase II complexes.
Bertolotti A
Molecular and Cellular Biology, 18(3), 1489-1497 (1998)
Macrothrombocytopenia and dense granule deficiency associated with FLI1 variants: ultrastructural and pathogenic features.
Saultier P
Haematologica, 102(6), 1006-1016 (2017)
Molecular characterization of an 11q interstitial deletion in a patient with the clinical features of Jacobsen syndrome.
Wenger SL
American Journal of Medical Genetics. Part A, 140(7), 704-708 (2006)
Exibir todos os documentos relacionados

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica