AV34910

Anti-CHRNA1 (AB2) antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-Cholinergic receptor, nicotinic, α-1 (muscle)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 52 kDa
• reatividade de espécies: human, guinea pig, bovine, horse, mouse, dog, rat, rabbit
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_000070
• nº de adesão UniProt: Q53SH4
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... CHRNA1(1134)

Descrição

Descrição geral

CHRNA1 encodes the α subunit of the muscle acetylcholine receptor and is involved in acetyl choline binding and channel gating functions. The expression of CHRNA1 in thymus tissues is controlled by IRF8 and AIRE.
Rabbit Anti-CHRNA1 recognizes mouse, bovine, canine, and human CHRNA1.

Imunogênio

Synthetic peptide directed towards the N terminal region of human CHRNA1

Aplicação

Rabbit Anti-CHRNA1 is suitable for western blot applications at a concentration of 0.5 μg/ml.

Ações bioquímicas/fisiológicas

The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 The CHRNA1 gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating.

Sequência

Synthetic peptide located within the following region: AGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVD

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 2
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable