Pular para o conteúdo
Merck
Todas as fotos(9)

Documentos Principais

AMAB91038

Sigma-Aldrich

Anti-S100B Antibody

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, mouse monoclonal, CL2720

Sinônimo(s):

S100beta

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.41

Nome do produto

Monoclonal Anti-S100B antibody produced in mouse, Prestige Antibodies® Powered by Atlas Antibodies, clone CL2720, purified immunoglobulin, buffered aqueous glycerol solution

fonte biológica

mouse

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

CL2720, monoclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human, rat, mouse

validação aprimorada

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnica(s)

immunoblotting: 1 μg/mL
immunohistochemistry: 1:500- 1:1000

Isotipo

IgG1

sequência de imunogênio

LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

nº de adesão UniProt

aplicação(ões)

research pathology

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... S100B(6285)

Descrição geral

The gene S-100 β subunit (S100B) is a 21kDa acidic protein. It is encoded by the gene mapped to human chromosome 21q22.3. The gene codes for a calcium-binding protein and is a member of S100 family of calcium-binding proteins. The encoded protein is produced predominantly by astrocytes. S100B is a homodimer with two β subunits.

Imunogênio

S100 calcium binding protein B

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Monoclonal Anti-S100B antibody produced in mouse has been used in immunocytochemistry and immunofluorescence studies.

Ações bioquímicas/fisiológicas

S-100 β subunit (S100B) exerts paracrine and autocrine effects on neurons and glia. At nanomolar concentrations, the encoded protein promotes neurite outgrowth and increases survival of neurons during development. S100B serves as a marker of melanocyte cytotoxicity. In addition, it also acts as a serum marker in endocrine resistant breast cancer and Nonsegmental Vitiligo. Decreased expression of S100B has been observed in chronic liver disease patients.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

forma física

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Os clientes também visualizaram

Slide 1 of 1

1 of 1

Decreased S100B expression in chronic liver diseases.
Baik S J, et al.
The Korean Journal of Internal Medicine, 32(2), 269?276-269?276 (2017)
S100β as a serum marker in endocrine resistant breast cancer.
Charmsaz S, et al.
BMC Medicine, 51(1), 79-79 (2017)
Rapid prenatal diagnosis of trisomy 21 by real-time quantitative polymerase chain reaction with amplification of small tandem repeats and S100B in chromosome 21.
Yang Y H, et al.
Yonsei Medical Journal, 46(6), 193-197 (2005)
Salil Sharma et al.
Scientific reports, 8(1), 9251-9251 (2018-06-20)
MicroRNAs (miRs) are 18~23 nucleotides long non-coding RNAs that regulate gene expression. To explore whether miR alterations in tauopathy contribute to pathological conditions, we first determined which hippocampal miRs are altered at the presymptomatic and symptomatic stages of tauopathy using
Reactive Astrocytes Promote ALS-like Degeneration and Intracellular Protein Aggregation in Human Motor Neurons by Disrupting Autophagy through TGF-β1.
Tripathi P, et al.
Stem Cell Reports, 9(2), 667-680 (2017)

Global Trade Item Number

SKUGTIN
AMAB91038-100UL4061837049033
AMAB91038-25UL4061841687108

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica