WH0007532M2

Monoclonal Anti-YWHAG antibody produced in mouse

clone 6A10, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-14-3-3 Gamma, Anti-Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 6A10, monoclonal
• Postać: buffered aqueous solution
• reaktywność gatunkowa: mouse, rat, human
• metody: indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG2bκ
• numer dostępu GenBank: NM_012479
• numer dostępu UniProt: P61981
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... YWHAG(7532)

Opis

Opis ogólny

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways. (provided by RefSeq)

Immunogen

YWHAG (NP_036611, 70 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTH

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)