WH0002019M2

Monoclonal Anti-EN1 antibody produced in mouse

clone 3E5, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-engrailed homolog 1
• Numer MDL: MFCD03096779
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 3E5, monoclonal
• Postać: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable
• izotyp: IgG2aκ
• numer dostępu GenBank: NM_001426
• numer dostępu UniProt: Q05925
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... EN1(2019)

Opis

Opis ogólny

Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the ′engrailed′ (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. (provided by RefSeq)

Immunogen

EN1 (NP_001417, 266 a.a. ~ 392 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE*

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)