SAB5702934

Anti-Engrailed 1 Antibody, clone 3B4K8, Rabbit Monoclonal

• Synonim(y): engrailed homeobox 1
• Kod UNSPSC: 12352203
• NACRES: NA.46
• klon: 3B4K8, monoclonal
• application: WB
• reaktywność gatunkowa: human, rat, rat
• metody: western blot: 1:500 - 1:2000

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• Materiały: colorless
• klon: 3B4K8, monoclonal
• Formularz: liquid
• masa cząsteczkowa: 50 kDa
• reaktywność gatunkowa: human, rat, rat
• stężenie: 0.49 mg/mL
• metody: western blot: 1:500 - 1:2000
• kolor: colorless
• izotyp: IgG
• sekwencja immunogenna: KLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE
• numer dostępu UniProt: Q05925
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... EN1(2019)

Opis

Opis ogólny

Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. [provided by RefSeq, Jul 2008]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 293-392 of human Engrailed 1 (Q05925).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Zastosowanie

WB

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1