SAB5702277

[KO Validated]Anti-SIRT3 Antibody, clone 7O4G7, Rabbit Monoclonal

• Synonim(y): SIRT3,SIR2L3,sirtuin 3
• Kod UNSPSC: 12352203
• NACRES: NA.46

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• Materiały: colorless
• klon: 7O4G7, monoclonal
• Formularz: liquid
• masa cząsteczkowa: 28 kDa
• reaktywność gatunkowa: rat, human, rat
• stężenie: 1 mg/mL
• metody: immunohistochemistry: 1:50 - 1:200; immunoprecipitation (IP): 1:500 - 1:1000; western blot: 1:500 - 1:1000
• kolor: colorless
• izotyp: IgG
• sekwencja immunogenna: QRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
• numer dostępu UniProt: Q9NTG7
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SIRT3(23410)

Opis

Opis ogólny

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Two alternatively spliced transcript variants that encode different proteins have been described for this gene.

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 300-399 of human SIRT3 (NP_036371.1).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Zastosowanie

WB, IHC, IP

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Piktogramy: GHS07,GHS09
• Hasło ostrzegawcze: Warning
• Zwroty wskazujące rodzaj zagrożenia: H317,H411
• Zwroty wskazujące środki ostrożności: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Klasyfikacja zagrożeń: Aquatic Chronic 2 - Skin Sens. 1
• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3