SAB2108342

Anti-SGK1 antibody produced in rabbit

affinity isolated antibody

• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 49kDa
• reaktywność gatunkowa: guinea pig, rabbit, bovine, human, mouse, rat, dog, horse
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunoblotting: suitable; immunohistochemistry: suitable
• numer dostępu NCBI: NM_005627
• numer dostępu UniProt: O00141
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SGK1(6446)

Opis

Opis ogólny

SGK1 (serum/glucocorticoid regulated kinase 1) codes for a serine/threonine kinase and it is structurally and functionally homologous to kinases of AKT (protein kinase B) family. SGK1 is ubiquitously expressed in all tissues and is predominant in kidney. The SKG1 gene is mapped to human chromosome 6q23.2.

Immunogen

Synthetic peptide directed towards the N terminal region of human SGK1

Działania biochem./fizjol.

The SGK1 (serum/glucocorticoid regulated kinase 1) gene is associated with a number of pathophysiological processes such as autophagy, ion transport, proliferation, metabolic, inflammation, syndrome and endoplasmic reticulum stress. Cellular dehydration, increased extracellular salt concentration, hormones such as glucocorticoids, mineralocorticoids, transforming growth factor β and mediators (cytokines) such as interleukin -6, stimulates SGK1 action. SGK1 gene expression is regulated by cellular signals involving cytosolic Ca²⁺, cyclic AMP (adenosine monophosphate), stress-activated protein kinase (SAPK2 (serine/threonine-protein kinase 2), p38 kinase), protein kinase C. Also, insulin and insulin-like growth factor, ERK (extracellular signal-regulated kinase) 1/2, and hepatic growth factor induces SGK1 transcription. Upregulation of SGK1 is observed in diabetes, liver cirrhosis, glomerulonephritis, dialysis and several tumors.

Sekwencja

Synthetic peptide located within the following region: ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable