HPA023882

Anti-FAT1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonim(y): Anti-Cadherin-related tumor suppressor homolog, Anti-Protein fat homolog, Anti-Protocadherin Fat 1
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA023882
• NACRES: NA.43

Właściwości

• pochodzenie biologiczne: rabbit
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Postać: buffered aqueous glycerol solution
• reaktywność gatunkowa: human
• metody: immunohistochemistry: 1:50- 1:200
• sekwencja immunogenna: NFQRALRNILGVRRNDIQIVSLQSSEPHPHLDVLLFVEKPGSAQISTKQLLHKINSSVTDIEEIIGVRILNVFQKLCAGLDCPWKFCDEKVSVDESVMSTHSTARLSFVTPRHHRAAVCLCKEGRCP
• numer dostępu UniProt: Q14517
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... FAT1(2195)

Opis

Opis ogólny

FAT atypical cadherin 1 (FAT1) protein is encoded by a gene mapped to human chromosome 4q34-35. The protein has ubiquitous expression in mammalian tissues, especially higher in kidney glomerular epithelial cells. FAT1 is localized to the leading edge of lamellipodia, filopodia, and microspike tips of cells. The protein is found to be abnormally expressed in pediatric patients with acute leukemia.
The encoded protein is characterized with cytoplasmic domain that is involved in assembly of components necessary to promote ectopic actin polymerization.

Immunogen

Protocadherin Fat 1 Precursor recombinant protein epitope signature tag (PrEST)

Zastosowanie

Anti-FAT1 antibody produced in rabbit has been used for western blotting. FAT1 antibody produced in rabbit has been used in immunofluorescence, tissue microarrays (TMAs) and immunohistochemistry (IHC).
All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Działania biochem./fizjol.

FAT atypical cadherin 1 (FAT1) acts as a proximal element of cell migration signaling pathways.FAT1 interacts with Ena/Vasodilator-stimulated phosphoprotein (VASP) at the leading edges of lamellipodia, filopodia, and microspike tips and helps in normal actin dynamics and cell polarization. FAT1, with or without β-catenin, might function as a novel biomarker for breast cancer. Mutation of FAT1 gene leads to T-cell acute lymphoblastic leukemia (T-ALL) in adults. In humans, FAT1 might act both as an oncogene and a tumor suppressor. The protein modulates oncogenic pathways in glioma cell lines. FAT1 also act as a co-activator of hypoxia and growth receptor signaling to critical tumorigenic pathways in hepatocellular carcinoma (HCC).

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST85143

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable