Przejdź do zawartości
Merck
Wszystkie zdjęcia(5)

Key Documents

SAB2101847

Sigma-Aldrich

Anti-POSTN antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-MGC119510, Anti-MGC119511, Anti-OSF-2, Anti-PDLPOSTN, Anti-Periostin, osteoblast specific factor

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(5)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

93 kDa

reaktywność gatunkowa

dog, mouse, human, pig, bovine

stężenie

0.5 mg - 1 mg/mL

metody

immunohistochemistry: suitable
western blot: suitable

numer dostępu UniProt

Q15063

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... POSTN(10631)

Immunogen

Synthetic peptide directed towards the middle region of human POSTN

Działania biochem./fizjol.

POSTN binds to heparin. It induces cell attachment and spreading and plays a role in cell adhesion. POSTN may play a role in extracellular matrix mineralization.

Sekwencja

Synthetic peptide located within the following region: VTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Buxian Tian et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 35(6), 5877-5883 (2014-04-11)
The objective of this study is to investigate the expression level of periostin in cancer stem cells as well as in the glioma tissues and the relationship between periostin expression and clinical and pathological characteristics and prognosis of gliomas. ESA+/CD133+/lin-
Munehisa Shimamura et al.
Hypertension research : official journal of the Japanese Society of Hypertension, 37(6), 494-499 (2014-03-22)
Periostin is an extracellular matrix glycoprotein and has various cellular effects. Previously, we demonstrated the neuroprotective effects of periostin during the acute stage of cerebral ischemia. However, its expression during the chronic stage remains unknown. Herein, we examined the expression
Zheyu Wang et al.
Nature biomedical engineering, 5(1), 64-76 (2021-01-24)
The detection and quantification of protein biomarkers in interstitial fluid is hampered by challenges in its sampling and analysis. Here we report the use of a microneedle patch for fast in vivo sampling and on-needle quantification of target protein biomarkers
Jie Chen et al.
Journal of cellular physiology, 229(11), 1647-1659 (2014-03-13)
Hertwig's epithelial root sheath (HERS) cells participate in cementum formation through epithelial-mesenchymal transition (EMT). Previous studies have shown that transforming growth factor beta 1 (TGF-β1) and fibroblast growth factor 2 (FGF2) are involved in inducing EMT. However, their involvement in

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej