SAB1412035

ANTI-FOXC2 antibody produced in mouse

clone 3H3, ascites fluid

• Synonim(y): FKHL14, FOXC2, LD, MFH-1, MFH1
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: ascites fluid
• rodzaj przeciwciała: primary antibodies
• klon: 3H3, monoclonal
• masa cząsteczkowa: antigen 34.65 kDa
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable
• izotyp: IgMλ
• numer dostępu NCBI: NM_005251
• numer dostępu UniProt: Q99958
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... FOXC2(2303)

Opis

Opis ogólny

This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. (provided by RefSeq)

Immunogen

FOXC2 (NP_005242.1, 421 a.a. ~ 501 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY

Postać fizyczna

Clear solution

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable