SAB1404094

Monoclonal Anti-MUC5AC antibody produced in mouse

clone 2A4, purified immunoglobulin, buffered aqueous solution

• Synonim(y): MUC5
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 2A4, monoclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen ~37.11 kDa
• reaktywność gatunkowa: human
• metody: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG2bκ
• numer dostępu NCBI: XM_495860
• numer dostępu UniProt: P98088
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... MUC5AC(4586)

Opis

Opis ogólny

The MUC5AC (mucin 5AC, oligomeric mucus/gel-forming) gene is mapped to human chromosome 11p15.5. Muc5ac is a gel-forming mucin of 40MDa, secreted by the goblet cells of the conjunctiva. Muc5ac is localized to the intermediate aqueous layer of tear film and predominant mucin in the respiratory tract. Muc5ac protein consists of cysteine-rich domains that flanks the central glycosylated tandem repeat domain.

Immunogen

MUC5AC (XP_495860, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH

Zastosowanie

Muc5ac (mucin 5AC, oligomeric mucus/gel-forming) provides hydration and lubrication effect for epithelial cells that make up cornea and conjunctiva. Parasympathetic and sympathetic nervous system (particularly, parasympathetic neurotransmitters acetylcholine and vasoactive intestinal peptide) controls the Muc5ac secretion. A number pathogens and cytokines can also stimulate Muc5ac secretion in the airway. MUC5AC gene expression is associated with a some pathological conditions such as allergen-induced airway hyperresponsiveness,airway mucus plugging, and mucous metaplasia.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable