Przejdź do zawartości
Merck
Wszystkie zdjęcia(4)

Key Documents

SAB1401382

Sigma-Aldrich

Anti-TFAM antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

Synonim(y):

MtTF1, TCF6, TCF6L1, TCF6L2, TCF6L3, mtTFA

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(4)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

mouse

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

reaktywność gatunkowa

human

metody

direct immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 1 μg/mL

numer dostępu NCBI

NM_003201.1

numer dostępu UniProt

Q00059

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... TFAM(7019)

Powiązane kategorie

Opis ogólny

This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells. (provided by RefSeq)
Transcription factor A, mitochondrial (TFAM) is encoded by the gene mapped to human chromosome 10q21.1. The gene codes for a DNA binding protein characterized with HMG (high mobility group)-box domains.

Immunogen

TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein.

Sequence
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC

Działania biochem./fizjol.

Transcription factor A, mitochondrial (TFAM) plays a vital role in transcription and replication of mammalian mitochondrial DNA (mtDNA). In addition, it is also implicated in mtDNA packaging. Polymorphism in the gene increases the risk of susceptibility to Alzheimer disease (AD). Additionally, mutation in the gene is associated with the development of mtDNA depletion syndrome.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Mutations in TFAM, encoding mitochondrial transcription factor A, cause neonatal liver failure associated with mtDNA depletion.
Stiles A R, et al.
Molecular genetics and metabolism reports, 119(1), 91-99 (2016)
Possible association of mitochondrial transcription factor A (TFAM) genotype with sporadic Alzheimer disease
Gunther C, et al.
Neuroscience Letters, 369(3), 219-223 (2004)
PGC-1alpha downstream transcription factors NRF-1 and TFAM are genetic modifiers of Huntington disease
Taherzadeh-Fard E, et al.
Mol. Neurodegener., 6(1), 32-32 (2011)
Tfam, a mitochondrial transcription and packaging factor, imposes a U-turn on mitochondrial DNA
Ngo H B, et al.
Nature Structural and Molecular Biology, 18(11), 1290-1290 (2011)
Daniel A Pulliam et al.
The Biochemical journal, 462(2), 359-371 (2014-06-10)
Mutations in SURF1 (surfeit locus protein 1) COX (cytochrome c oxidase) assembly protein are associated with Leigh's syndrome, a human mitochondrial disorder that manifests as severe mitochondrial phenotypes and early lethality. In contrast, mice lacking the SURF1 protein (Surf1-/-) are
Wyświetl wszystkie powiązane dokumenty

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej