Przejdź do zawartości
Merck
Wszystkie zdjęcia(4)

Key Documents

HPA037655

Sigma-Aldrich

Anti-GUCY2C antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):

Anti-GUC2C, Anti-Guanylate cyclase 2C (heat stable enterotoxin receptor), Anti-STAR

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
Numer w atlasie ludzkich białek:
NACRES:
NA.41

pochodzenie biologiczne

rabbit

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

Postać

buffered aqueous glycerol solution

reaktywność gatunkowa

human

metody

immunohistochemistry: 1:200-1:500

sekwencja immunogenna

EVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTD

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... GUCY2C(2984)

Opis ogólny

The guanylate cyclase 2C (GUCY2C) gene, mapped to human chromosome 12p12, codes for the transmembrane receptor guanylate cyclase C (GC-C). The encoded protein is expressed in intestine.

Immunogen

guanylate cyclase 2C (heat stable enterotoxin receptor) recombinant protein epitope signature tag (PrEST)

Zastosowanie

GUCY2C antibody produced in rabbit has been used for western blot analysis.

Działania biochem./fizjol.

Transmembrane receptor guanylate cyclase C (GC-C), encoded by guanylate cyclase 2C (GUCY2C), regulates the secretion of chloride. Alteration in the gene expression leads to congenital sodium diarrhoea (CSD). GUCY2C catalyzes the conversion of guanosine-5′-triphosphate (GTP) to cyclic guanosine monophosphate (cGMP), upon binding of its ligand guanylin and uroguanylin, which are paracrine hormones. GUCY2C functions as a tumor suppressor and hinders intestinal tumorigenesis by inhibiting the protein kinase B/AKT signaling pathway.

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST79587

Postać fizyczna

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 1

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Guanylin and uroguanylin stimulate lipolysis in human visceral adipocytes.
Rodriguez A
International Journal of Obesity, 40, 1405-1415 (2016)
Congenital secretory diarrhoea caused by activating germline mutations in GUCY2C.
Muller T
Gut, 65, 1306-1313 (2016)
A Rodríguez et al.
International journal of obesity (2005), 40(9), 1405-1415 (2016-04-26)
Uroguanylin and guanylin are secreted by intestinal epithelial cells as prohormones postprandially and act on the hypothalamus to induce satiety. The impact of obesity and obesity-associated type 2 diabetes (T2D) on proguanylin and prouroguanylin expression/secretion as well as the potential
Øystein Brenna et al.
Scandinavian journal of gastroenterology, 50(10), 1241-1252 (2015-05-17)
Activation of membrane receptor guanylate cyclase-C (GC-C) is implicated in gastrointestinal fluid and electrolyte balance, preservation of intestinal barrier integrity, anti-trophic effects and inhibition of pain sensation. To evaluate GC-C signaling, we examined the regulation of GC-C (GUCY2C/Gucy2c) and its
The hormone receptor GUCY2C suppresses intestinal tumor formation by inhibiting AKT signaling.
Lin JE
Gastroenterology, 138, 241-254 (2010)

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej