HPA037606

Anti-CEP164 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonim(y): Anti-KIAA1052, Anti-NPHP15
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA037606
• NACRES: NA.43

Właściwości

• pochodzenie biologiczne: rabbit
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Postać: buffered aqueous glycerol solution
• reaktywność gatunkowa: human
• metody: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• sekwencja immunogenna: DASQELEISEHMKEPQLSDSIASDPKSFHGLDFGFRSRISEHLLDVDVLSPVLGGACRQAQQPLGIEDKDDSQSSQDELQSKQSKGLEERLSPPLPHE
• numer dostępu UniProt: Q9UPV0
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... CEP164(22897)

Opis

Opis ogólny

Centrosomal protein 164 (CEP164) is a centriole appendage protein encoded by the gene mapped to human chromosome 11q23.3. CEP164 is apparently a 164kDa protein composed of 1,460 amino acids and is specifically localized on mature centrioles. The encoded protein mainly contains a putative N-terminal WW domain and three coiled-coil domains.

Immunogen

centrosomal protein 164kDa recombinant protein epitope signature tag (PrEST)

Działania biochem./fizjol.

Centrosomal protein 164 (CEP164) plays an essential role in primary cilium formation. In addition, it also acts as a potential marker for distal appendages on mature centrioles or basal bodies. Mutation in the gene is associated with early defects in ciliogenesis. CEP164 directs tau tubulin kinase 2 (TTBK2) to the mother centriole and thus stimulates ciliogenesis.

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST80528

Postać fizyczna

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable