HPA015497

Anti-TMEM115 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonim(y): Anti-PP6, Anti-Placental protein 6, Anti-Protein PL6, Anti-Transmembrane protein 115
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA015497
• NACRES: NA.43

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Formularz: buffered aqueous glycerol solution
• reaktywność gatunkowa: human
• metody: immunohistochemistry: 1:50- 1:200
• sekwencja immunogenna: KTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITF
• numer dostępu UniProt: Q12893
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... TMEM115(11070)

Opis

Opis ogólny

TMEM115 (transmembrane protein 115) is a receptor-like transmembrane Golgi-resident protein, which spans the membrane six to eight times. This gene is localized to human chromosome 3p21.3, spans 4.5kb, and consists of two exons. The encoded 2.2kb mRNA is expressed in multiple normal human tissues such as, breast, lung and kidney. It has a strong and ubiquitous expression pattern in embryo and placenta. This protein is also co-expressed with RAS oncogenic protein family members. It has a pheromone-binding domain, which consists of a rhomboid-like motif. The N- and C-termini face the cytosol, with the C-terminal being composed of ~146 amino acids, and is hydrophobic in nature. The molecular weight of this protein is ~35kDa.

Immunogen

Transmembrane protein 115 recombinant protein epitope signature tag (PrEST)

Zastosowanie

Anti-TMEM115 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Działania biochem./fizjol.

TMEM115 (transmembrane protein 115) might be involved in signaling pathways. This gene is severely down-regulated in clear cell renal cell carcinomas (CC-RCCs). This expression pattern is dependent on von Hippel-Lindau tumor suppressor gene (VHL)-association of the cancer, rather than hypoxia or HIF1 (hypoxia-inducible factor). It interacts with conserved oligomeric Golgi (COG) complex, and is involved in Golgi-to-ER (endoplasmic reticulum) retrograde transport, which controls Golgi stacks. This protein also plays an essential role in O-linked glycosylation.

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST73276

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)