HPA010593

Anti-FOLH1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonim(y): Anti-Glutamate carboxypeptidase 2 antibody produced in rabbit, Anti-Glutamate carboxypeptidase II antibody produced in rabbit, Anti-Membrane glutamate carboxypeptidase antibody produced in rabbit, Anti-N-acetylated-α-linked acidic dipeptidase I antibody produced in rabbit, Anti-NAALADase I antibody produced in rabbit, Anti-Pteroylpoly-γ-glutamate carboxypeptidase antibody produced in rabbit, Anti-mGCP antibody produced in rabbit
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA010593
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Formularz: buffered aqueous glycerol solution
• reaktywność gatunkowa: human
• rozszerzona walidacja: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• metody: immunohistochemistry: 1:200- 1:500
• sekwencja immunogenna: ADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNF
• numer dostępu UniProt: Q04609
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... FOLH1(2346)

Opis

Opis ogólny

FOLH1 (folate hydrolase 1) is a type II membrane protein, which is composed of a cytosolic domain, a transmembrane region, and an exoplasmic region. This protein exhibits both constitutive and induced internalization. It is an exopeptidase, which is Zn-dependent and is localized on the brush-border of the intestine.

Immunogen

Glutamate carboxypeptidase 2 recombinant protein epitope signature tag (PrEST)

Zastosowanie

Anti-FOLH1 antibody produced in rabbit has been used for FACS (flourescence activated cell sorting)-based epitope mapping. Anti-FOLH1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Działania biochem./fizjol.

FOLH1 (folate hydrolase 1) is also known as prostate-specific membrane antigen (PSMA) and is over and strongly expressed in prostate cancer cells, including metastatic cells. This protein functions both as an N-acetylated a-linked acidic dipeptidase (NAALADase) and folate hydrolase (FOLH). In small intestine, it is responsible for the absorption of dietary polyglutamylated folates (folyl-n-γ-l-glutamic acid), which are the provitamin form of folic acid. Variants in this gene are linked with folate nutritional status and disease susceptibility, and its interaction with dietary natural vitamin C might be linked with the susceptibility to adenomatous polyp.

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST71680

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)