AV48247

Anti-SEP15 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-Selenoprotein 15 kDa
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 15 kDa
• reaktywność gatunkowa: mouse, rat, pig, human
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_004252
• numer dostępu UniProt: O60613
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SEP15(9403)

Opis

Opis ogólny

SEP15 is a selenoprotein that regulates the unfolded protein response. It is modulated by ER stresses. SEP15 variations have been linked to the risk of lung cancer.
Rabbit Anti-SEP15 antibody recognizes bovine, zebrafish, pig, human, mouse, rat, and canine SEP15.

Immunogen

Synthetic peptide directed towards the middle region of human SEP15

Zastosowanie

Rabbit Anti-SEP15 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Działania biochem./fizjol.

SEP15 is a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. Studies in mouse suggest that this selenoprotein may have redox function and may be involved in the quality control of protein folding. The gene that encodes the protein is localized on chromosome 1p31, a genetic locus commonly mutated or deleted in human cancers. This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3′ UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Studies in mouse suggest that this selenoprotein may have redox function and may be involved in the quality control of protein folding. This gene is localized on chromosome 1p31, a genetic locus commonly mutated or deleted in human cancers. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Sekwencja

Synthetic peptide located within the following region: SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable