Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Key Documents

AV48246

Sigma-Aldrich

Anti-RAB11B antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-H-YPT3, Anti-MGC133246, Anti-RAB11B, member RAS oncogene family

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(1)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

masa cząsteczkowa

24 kDa

reaktywność gatunkowa

bovine, rat, mouse, goat, dog, human, guinea pig

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_004209

numer dostępu UniProt

Q15907

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... RAB11B(9230)

Powiązane kategorie

Opis ogólny

RAB11B is a GTP-binding protein that regulates diverse cellular functions.It is expressed in vesicular compartments in parietal and epithelial cells. Neuronal Rab11b has been implicated in exocytosis.
Rabbit Anti-RAB11B antibody recognizes zebrafish, human, mouse, rat, canine, chicken, and bovine RAB11B.

Immunogen

Synthetic peptide directed towards the C terminal region of human RAB11B

Zastosowanie

Rabbit Anti-RAB11B antibody is suitable for western blot applications at a concentration of 0.25 μg/ml.

Działania biochem./fizjol.

RAB11B possesses GTPase activity.

Sekwencja

Synthetic peptide located within the following region: IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Lynne A Lapierre et al.
Experimental cell research, 290(2), 322-331 (2003-10-22)
The Rab11 family of small GTPases is composed of three members, Rab11a, Rab11b, and Rab25. While recent work on Rab11a and Rab25 has yielded some insights into their function, Rab11b has received little attention. Therefore, we sought to examine the
Mikhail V Khvotchev et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 23(33), 10531-10539 (2003-11-25)
Using PC12 cells that express transfected human growth hormone (hGH) as a secreted reporter protein, we have searched for Rab proteins that function in exocytosis. Among the Rab proteins tested, we found that besides the previously described Rab3 proteins, only

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej