Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Kluczowe dokumenty

AV46061

Sigma-Aldrich

Anti-BLK antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-B lymphoid tyrosine kinase, Anti-MGC10442

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(1)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Formularz

buffered aqueous solution

masa cząsteczkowa

58 kDa

reaktywność gatunkowa

mouse, human, rat, pig

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_001706

numer dostępu UniProt

P51451

Warunki transportu

wet ice

temp. przechowywania

−20°C

informacje o genach

human ... BLK(640)

Powiązane kategorie

Immunogen

Synthetic peptide directed towards the middle region of human BLK

Zastosowanie

Anti-BLK antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Działania biochem./fizjol.

BLK, also known as B lymphoid kinase, is a 55kDa tyrosine kinase with SH3, SH2 and catalytic domains that contain consensus sequences of the Src protein tyrosine kinase family. BLK is expressed specifically in the B cell lineage and plays a role in signal transduction pathway that is restricted to B lymphoid cells. Stimulation of resting B-lymphocytes with antibodies to surface immunoglobulin (sIgD or sIgM) induces activation of BLK.

Sekwencja

Synthetic peptide located within the following region: AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAY

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number
QC16252

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Wyszukaj dokument COA

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

A L Burkhardt et al.
Proceedings of the National Academy of Sciences of the United States of America, 88(16), 7410-7414 (1991-08-15)
Stimulation of resting B lymphocytes with antibodies to surface immunoglobulin (sIgD or sIgM) induces protein tyrosine phosphorylation, implicating one or more B-cell protein-tyrosine kinases (PTKs) in sIg signal transduction. We have evaluated whether members of the src family of PTKs
S M Dymecki et al.
Science (New York, N.Y.), 247(4940), 332-336 (1990-01-19)
Several pathways of transmembrane signaling in lymphocytes involve protein-tyrosine phosphorylation. With the exception of p56lck, a tyrosine kinase specific to T lymphoid cells that associates with the T cell transmembrane proteins CD4 and CD8, the kinases that function in these

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej