AV46142

Anti-PSME3 (AB1) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-Ki, Anti-PA28-gamma, Anti-PA28G, Anti-Proteasome (prosome, macropain) activator subunit 3 (PA28 γ; Ki), Anti-REG-GAMMA
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 31 kDa
• reaktywność gatunkowa: rat, human, bovine, horse, mouse, guinea pig, rabbit, dog
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunohistochemistry: suitable; western blot: suitable
• numer dostępu NCBI: NP_005780
• numer dostępu UniProt: P61289-2
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... PSME3(10197)

Opis

Immunogen

Synthetic peptide directed towards the N-terminal region of Human PSME3

Zastosowanie

Anti-PSME3 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.

Działania biochem./fizjol.

Proteasomes are protein complexes that facilitate the degradation of damaged proteins by proteolysis. Proteasomes are located throughout the eukaryotic cells but primarily localized in nucleus. They are composed of 2 complexes, a 20S core and a 19S regulator. The modified proteasome referred to as immunoproteasome contains an alternate regulator that is 11S regulator or PA28 against 19S regulator. PSME3 gene encodes the gamma subunit of the 11S regulator. REG-gamma (also known as PA28-gamma) stimulates the trypsin-like catalytic subunit of the proteasome but inhibits the chymotrypsin-like and postglutamyl-preferring (PGPH) subunits. REG-gamma interact with both MDM2 and p53 proteins and stimulates ubiquitination- and MDM2-dependent proteasomal degradation of p53 which in turn restricts its accumulation and inhibits apoptosis after DNA damage.

Sekwencja

Synthetic peptide located within the following region: PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable