Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Dokumenty

AV46142

Sigma-Aldrich

Anti-PSME3 (AB1) antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-Ki, Anti-PA28-gamma, Anti-PA28G, Anti-Proteasome (prosome, macropain) activator subunit 3 (PA28 γ; Ki), Anti-REG-GAMMA

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(2)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

31 kDa

reaktywność gatunkowa

rat, human, bovine, horse, mouse, guinea pig, rabbit, dog

stężenie

0.5 mg - 1 mg/mL

metody

immunohistochemistry: suitable
western blot: suitable

numer dostępu NCBI

NP_005780

numer dostępu UniProt

P61289-2

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... PSME3(10197)

Immunogen

Synthetic peptide directed towards the N-terminal region of Human PSME3

Zastosowanie

Anti-PSME3 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.

Działania biochem./fizjol.

Proteasomes are protein complexes that facilitate the degradation of damaged proteins by proteolysis. Proteasomes are located throughout the eukaryotic cells but primarily localized in nucleus. They are composed of 2 complexes, a 20S core and a 19S regulator. The modified proteasome referred to as immunoproteasome contains an alternate regulator that is 11S regulator or PA28 against 19S regulator. PSME3 gene encodes the gamma subunit of the 11S regulator. REG-gamma (also known as PA28-gamma) stimulates the trypsin-like catalytic subunit of the proteasome but inhibits the chymotrypsin-like and postglutamyl-preferring (PGPH) subunits. REG-gamma interact with both MDM2 and p53 proteins and stimulates ubiquitination- and MDM2-dependent proteasomal degradation of p53 which in turn restricts its accumulation and inhibits apoptosis after DNA damage.

Sekwencja

Synthetic peptide located within the following region: PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Not finding the right product?  

Try our Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

J M Peters et al.
The Journal of biological chemistry, 269(10), 7709-7718 (1994-03-11)
The 26 S proteolytic complex ("26 S proteasome") is a macromolecular assembly thought to be involved in ATP- and ubiquitin-dependent protein degradation in the cytoplasm of higher eukaryotic cells. This complex is composed of one 20 S cylinder particle (multicatalytic
Xiaolin Gao et al.
Archives of biochemistry and biophysics, 425(2), 158-164 (2004-04-28)
The proteasome activation properties of recombinant REG gamma molecules depend on purification procedures. Prior to ammonium sulfate precipitation recombinant REG gamma activates the trypsin-like catalytic subunit of the proteasome; afterwards it activates all three catalytic subunits. The expanded activation specificity
Zhuo Zhang et al.
The EMBO journal, 27(6), 852-864 (2008-03-01)
Downregulation of p53 by MDM2-mediated proteasomal degradation makes cells resistant to apoptosis. The MDM2-p53 interaction is well characterized, but the mechanisms that regulate the interaction are not well understood. Here, we show that PA28gamma, a proteasome activator that inhibits apoptosis

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej