Przejdź do zawartości
Merck
Wszystkie zdjęcia(3)

Key Documents

AV46114

Sigma-Aldrich

Anti-APOBEC3B antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-APOBEC1L, Anti-ARCD3, Anti-ARP4, Anti-Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B, Anti-DJ742C19.2, Anti-FLJ21201, Anti-PHRBNL, Anti-bK150C2.2

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(3)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

46 kDa

reaktywność gatunkowa

human

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NP_004891

numer dostępu UniProt

Q9UH17

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... APOBEC3B(9582)

Immunogen

Synthetic peptide directed towards the N terminal region of human APOBEC3B

Zastosowanie

Anti-APOBEC3B antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

Działania biochem./fizjol.

APOBEC3B is a member of the cytidine deaminase gene family and encodes apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B. Endogenous APOBEC3B is a principal nuclear protein that facilitates the DNA C-to-U editing activity in breast cancer cell-line extracts. APOBEC3B exhibits antiviral activity against human T-cell leukemia virus type 1 (HTLV-1) and is a potent inhibitor of simian immunodeficiency virus (SIV) replication.

Sekwencja

Synthetic peptide located within the following region: NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Marcel Ooms et al.
Journal of virology, 86(11), 6097-6108 (2012-03-30)
The human APOBEC3 family consists of seven cytidine deaminases (A3A to A3H), some of which display potent antiretroviral activity against HIV-1 and other retroviruses. Studies that analyzed the effect of A3G on human T-lymphotropic virus type 1 (HTLV-1) infectivity resulted
Michael B Burns et al.
Nature, 494(7437), 366-370 (2013-02-08)
Several mutations are required for cancer development, and genome sequencing has revealed that many cancers, including breast cancer, have somatic mutation spectra dominated by C-to-T transitions. Most of these mutations occur at hydrolytically disfavoured non-methylated cytosines throughout the genome, and
Qin Yu et al.
The Journal of biological chemistry, 279(51), 53379-53386 (2004-10-07)
In the human genome the apolipoprotein B mRNA-editing enzyme catalytic polypeptide (APOBEC)3 gene has expanded into a tandem array of genes termed APOBEC3A-G. Two members of this family, APOBEC3G and APOBEC3F, have been found to have potent activity against virion

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej