Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Key Documents

AV43935

Sigma-Aldrich

Anti-SLC16A8 antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-MCT3, Anti-Solute carrier family 16, member 8 (monocarboxylic acid transporter 3)

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(2)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

52 kDa

reaktywność gatunkowa

guinea pig, human

stężenie

0.5 mg - 1 mg/mL

metody

immunohistochemistry: suitable
western blot: suitable

numer dostępu NCBI

NP_037488

numer dostępu UniProt

O95907

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... SLC16A8(23539)

Immunogen

Synthetic peptide directed towards the middle region of human SLC16A8

Zastosowanie

Anti-SLC16A8 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Działania biochem./fizjol.

SLC16A8 (MCT3) is a proton-coupled monocarboxylate transporter that facilitates the movement of lactate across the cell membranes. Mutation in the gene for MCT3 results in altered visual function in mice and has been associated with age-related macular degeneration.

Sekwencja

Synthetic peptide located within the following region: RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

11 - Combustible Solids

Klasa zagrożenia wodnego (WGK)

WGK 1

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Lars G Fritsche et al.
Nature genetics, 45(4), 433-439 (2013-03-05)
Age-related macular degeneration (AMD) is a common cause of blindness in older individuals. To accelerate the understanding of AMD biology and help design new therapies, we executed a collaborative genome-wide association study, including >17,100 advanced AMD cases and >60,000 controls
Lauren L Daniele et al.
American journal of physiology. Cell physiology, 295(2), C451-C457 (2008-06-06)
To meet the high-energy demands of photoreceptor cells, the outer retina metabolizes glucose through glycolytic and oxidative pathways, resulting in large-scale production of lactate and CO(2). Mct3, a proton-coupled monocarboxylate transporter, is critically positioned to facilitate transport of lactate and
Timothy A Blenkinsop et al.
Investigative ophthalmology & visual science, 56(12), 7085-7099 (2015-11-06)
We tested what native features have been preserved with a new culture protocol for adult human RPE. We cultured RPE from adult human eyes. Standard protocols for immunohistochemistry, electron microscopy, electrophysiology, fluid transport, and ELISA were used. Confluent monolayers of
H Yoon et al.
Genomics, 60(3), 366-370 (1999-09-24)
Lactate transport across cell membranes is mediated by a family of proton-coupled monocarboxylate transporters (MCTs). The retinal pigment epithelium (RPE) expresses a unique member of this family, MCT3. A portion of the human MCT3 gene was cloned by polymerase chain

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej