AV39466

Anti-NR2F2 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Synonim(y): Anti-Nuclear receptor subfamily 2, group F, member 2
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 46 kDa
• reaktywność gatunkowa: dog, rabbit, human, guinea pig, sheep, horse, rat, mouse, bovine
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_066285
• numer dostępu UniProt: P24468
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... NR2F2(7026)

Opis

Opis ogólny

COUP transcription factor 2/nuclear receptor subfamily 2, group F, member 2 (COUP-TFII, NR2F2) is a nuclear receptor that regulates amygdale patterning via expression of neurophilin.COUP-TFII is a component of the glucagon-like peptide 1 (GLP-1) signaling cascade that stimulates neonatal β-cell number. COUP-TFII is required for GLP-1 activation of the β-catenin-dependent pathway.

Specyficzność

Anti-NR2F2 (AB1) polyclonal antibody reacts with chicken, bovine, pig, zebrafish, human, mouse, rat, and canine COUP transcription factor 2 proteins.

Immunogen

Synthetic peptide directed towards the C terminal region of human NR2F2

Zastosowanie

Anti-NR2F2 (AB1) polyclonal antibody is used to tag COUP transcription factor 2/nuclear receptor subfamily 2, group F, member 2 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of COUP transcription factor 2 in cell signaling pathways such as the glucagon-like peptide 1 (GLP-1) signaling cascade.

Działania biochem./fizjol.

NR2F2, an orphan member of the nuclear hormone receptor superfamily, acts as a transcriptional repressor by antagonizing the functions of other nuclear hormone receptors and by actively silencing transcription. However, in certain contexts, NR2F2 stimulates transcription directly. NR2F2, MyoD and p300 interact in a competitive manner, and that increasing amounts of NR2F2 have the ability to reduce the interaction between myoD and p300 invitro. NR2F2 post-transcriptionally regulates myoD activity/function, and that crosstalk between orphan nuclear receptors and the myogenic bHLH proteins has functional consequences for differentiation.

Sekwencja

Synthetic peptide located within the following region: EYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable