Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Kluczowe dokumenty

AV33542

Sigma-Aldrich

Anti-ANKRD11 antibody produced in rabbit

IgG fraction of antiserum

Synonim(y):

Anti-Ankyrin repeat domain 11

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

IgG fraction of antiserum

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

298 kDa

reaktywność gatunkowa

bovine, horse, rabbit, dog, rat, mouse, human

stężenie

0.5 mg - 1 mg/mL

metody

immunohistochemistry: suitable
western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... ANKRD11(29123)

Opis ogólny

ANKRD11 is a member of a family of ankyrin repeat-containing cofactors that interacts with p160 nuclear receptor coactivators and inhibits ligand-dependent transcriptional activation by recruiting histone deacetylases to the complex. Recently, ANKRD11 was shown to bind to the tumor suppressor gene p53 and enhance its activity.

Immunogen

Synthetic peptide directed towards the N terminal region of human ANKRD11

Działania biochem./fizjol.

ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.

Sekwencja

Synthetic peptide located within the following region: KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Aihua Zhang et al.
The Journal of biological chemistry, 279(32), 33799-33805 (2004-06-09)
Members of the p160 nuclear receptor coactivators interact with liganded nuclear receptors to enhance transcription of target genes. Here we identify a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with the p160 coactivators. ANCO-1 binds to the
Paul M Neilsen et al.
Journal of cell science, 121(Pt 21), 3541-3552 (2008-10-09)
The ability of p53 to act as a transcription factor is critical for its function as a tumor suppressor. Ankyrin repeat domain 11, ANKRD11 (also known as ANR11 or ANCO1), was found to be a novel p53-interacting protein that enhanced

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej