Przejdź do zawartości
Merck
Wszystkie zdjęcia(3)

Kluczowe dokumenty

AV32612

Sigma-Aldrich

Anti-TBX21 antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-HGNC:11599, Anti-T-PET, Anti-T-bet, Anti-T-box Transcription factor, Anti-TBLYM

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

58 kDa

reaktywność gatunkowa

pig, dog, bovine, human

stężenie

0.5 mg - 1 mg/mL

metody

immunohistochemistry: suitable
western blot: suitable

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... TBX21(30009)

Opis ogólny

Rabbit polyclonal anti-TBX21 antibody reacts with canine, bovine, pig, human, mouse, and rat T-box transcription factor 21 transcription factors.
T-box genes encode transcription factors that regulate developmental processes. T-box transcription factor 21 (TBX21) is the human ortholog of mouse Tbx21/Tbet, a lineage commitment regulator for the differentiation of interferon-gamma (IFNG) producting CD4 T helper (Th1) 1 cells.
TBX21 is involved in the development of T-lymphocytes. Functional TBX21 variations have been associated with aspirin-induced asthmaand have been linked to clinical outcomes for inhaled corticosteroid therapy in asthma patients.

Immunogen

Synthetic peptide directed towards the middle region of human TBX21

Zastosowanie

Rabbit Anti-TBX21 antibody can be used for western blot applications at a concentration of 1.0-2.0μg/ml. It can also be used for IHC at 4-8μg/ml using paraffin-embedded tissues.
Rabbit polyclonal anti-TBX21 antibody is used to tag T-box 21 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of T-box transcription factor 21 in the differentiation of interferon-gamma (IFNG) producting CD4 T helper 1 (Th1) cells.

Działania biochem./fizjol.

TBX21 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. It is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells.

Sekwencja

Synthetic peptide located within the following region: SIPSPPGPNCQFLGGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWL

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Mitsuteru Akahoshi et al.
Human genetics, 117(1), 16-26 (2005-04-05)
Asthma is a phenotypically heterogeneous disorder with many etiologic factors and clinical characteristics. T-bet, a Th1-specific transcription factor of T-box family, has been found to control interferon-gamma (IFN-gamma) expression in T cells. Mice lacking the T-bet gene (tbx21) demonstrate multiple
Kelan G Tantisira et al.
Proceedings of the National Academy of Sciences of the United States of America, 101(52), 18099-18104 (2004-12-18)
TBX21 encodes for the transcription factor T-bet (T-box expressed in T cells), which influences naive T lymphocyte development and has been implicated in asthma pathogenesis. Specifically, the T-bet knockout mouse spontaneously develops airway hyperresponsiveness and other changes consistent with asthma.
Judy T Tellam et al.
PLoS pathogens, 10(10), e1004423-e1004423 (2014-10-10)
Recent studies have shown that virally encoded mRNA sequences of genome maintenance proteins from herpesviruses contain clusters of unusual structural elements, G-quadruplexes, which modulate viral protein synthesis. Destabilization of these G-quadruplexes can override the inhibitory effect on self-synthesis of these

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej