AV32443

Anti-LHX3 (AB1) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-LIM homeobox 3
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 43 kDa
• reaktywność gatunkowa: human
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NP_835258
• numer dostępu UniProt: Q9UBR4
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• informacje o genach: human ... LHX3(8022)

Opis

Opis ogólny

LHX3 is a LIM homeodomain protein that functions as a transcription factor and is required for the development of pituitary gland. It also determines the cell types that secrete anterior pituitary hormones. Mutations in LHX3 have been linked to combined pituitary hormone deficiency in humans.
Rabbit Anti-LHX3 (AB1) antibody recognizes canine, human, zebrafish, bovine, chicken, pig, and mouse LHX3.

Immunogen

Synthetic peptide directed towards the middle region of human LHX3

Zastosowanie

Rabbit Anti-LHX3 (AB1) antibody can be used for western blot applications at a concentration of 0.5μg/ml.

Działania biochem./fizjol.

LHX3 is a member a large protein family which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene have been associated with a syndrome of combined pituitary hormone deficiency and rigid cervical spine. Two transcripts variants encoding distinct isoforms have been identified for this gene.

Sekwencja

Synthetic peptide located within the following region: NMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEP

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable