AV31464

Anti-OLIG2 (AB2) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-BHLHB1, Anti-OLIGO2, Anti-Oligodendrocyte lineage transcription factor 2, Anti-PRKCBP2, Anti-RACK17
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 32 kDa
• reaktywność gatunkowa: rat, human, mouse, dog, guinea pig, horse
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunohistochemistry: suitable; western blot: suitable
• numer dostępu NCBI: NP_005797
• numer dostępu UniProt: Q13516
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... OLIG2(10215)

Opis

Opis ogólny

OLIG2 is a basic helix-loop-helix (bHLH) transcription factor that is expressed in the spinal cord. This transcription factor is involved in the development of oligodendrocytes and motor neurons. OLIG2 may be useful as a diagnostic marker of oligodendroglial cancer.
Rabbit Anti-OLIG2 (AB2) antibody recognizes chicken, human, mouse, rat, and bovine OLIG2.

Immunogen

Synthetic peptide directed towards the N terminal region of human OLIG2

Zastosowanie

Rabbit Anti-OLIG2 (AB2) antibody is suitable for use in western blot applications at a concentration of 1μg/ml.

Działania biochem./fizjol.

OLIG2 is a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. OLIG2 is an essential regulator of ventral neuroectodermal progenitor cell fate. It is associated with T-cell acute lymphoblastic leukemia due to a chromosomal translocation t(14;21)(q11.2;q22). OLIG2 might play a role in learning deficits associated with Down syndrome.This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sekwencja

Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable