AMAB91116

Monoclonal Anti-SLC6A2 antibody produced in mouse

Prestige Antibodies^® Powered by Atlas Antibodies, clone CL3063, purified immunoglobulin, buffered aqueous glycerol solution

• Synonim(y): NAT1, NET1, SLC6A2, SLC6A5
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: AMAB91116
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: CL3063, monoclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Postać: buffered aqueous glycerol solution
• reaktywność gatunkowa: human, rat, mouse
• metody: immunohistochemistry: 1:200-1:500
• izotyp: IgG1
• sekwencja immunogenna: SLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNGSVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIHDI
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... NET(6530)

Opis

Opis ogólny

Sodium-dependent noradrenaline transporter (NET) is also called solute carrier family 6 member 2 (SLC6A2). The SLC6A2 gene is mapped to locus 16q12.2 in the human chromosome. The sodium-dependent noradrenaline transporter (NET) belongs to sodium and chloride-dependent neurotransmitter transporter family and is a glycosylated protein.

Immunogen

Solute carrier family 6 member 2

Zastosowanie

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Działania biochem./fizjol.

Regulation of noradrenalin transport is the primary function of the norepinephrine transporter (NET).It is crucial for neuronal function and regulates neurotransmitter uptake in the central nervous system. Polymorphisms in NET gene is implicated in attention-deficit/hyperactivity disorder (ADHD). Mutations in NET impacts the transport functionality resulting in orthostatic intolerance disorder. Polymorphisms of SLC6A2 impacts neurotransmission in patients with major depressive disorder.

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST86859

Postać fizyczna

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1