AMAB90905
Monoclonal Anti-CD40 antibody produced in mouse
Prestige Antibodies® Powered by Atlas Antibodies, clone CL1673, purified immunoglobulin, buffered aqueous glycerol solution
Synonim(y):
Anti-Bp50, Anti-TNFRSF5, Anti-p50
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Kod UNSPSC:
12352203
NACRES:
NA.41
Polecane produkty
pochodzenie biologiczne
mouse
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
purified immunoglobulin
rodzaj przeciwciała
primary antibodies
klon
CL1673, monoclonal
linia produktu
Prestige Antibodies® Powered by Atlas Antibodies
Formularz
buffered aqueous glycerol solution
reaktywność gatunkowa
human
rozszerzona walidacja
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
metody
immunoblotting: 1 μg/mL
immunohistochemistry: 1:2500-1:5000
izotyp
IgG1
sekwencja immunogenna
KQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCE
numer dostępu UniProt
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... CD40(958)
Opis ogólny
Cluster of differentiation 40 (CD40) is a type I transmembrane glycoprotein. It has a molecular weight of about 40-50kDa and is made of 277 amino acids. The CD40 gene is mapped to human chromosome 20q11-13 and has nine exons.
Immunogen
CD40 molecule, TNF receptor superfamily member 5
Zastosowanie
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Monoclonal Anti-CD40 Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using protein array and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/ Prestige.
Działania biochem./fizjol.
Cluster of differentiation 40 (CD40) plays a major role in cellular and humoral immunity. It initiates inflammatory response to induce the progression of atherosclerosis. The CD40 pathway participates in the growth and pathogenesis of autoimmune diseases like rheumatoid arthritis (RA).
Cechy i korzyści
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Powiązanie
Corresponding Antigen APREST78053
Postać fizyczna
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informacje prawne
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 1
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Wybierz jedną z najnowszych wersji:
Certyfikaty analizy (CoA)
Lot/Batch Number
Przepraszamy, ale COA dla tego produktu nie jest aktualnie dostępny online.
Proszę o kontakt, jeśli potrzebna jest pomoc Obsługa Klienta
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
CD40 functional gene polymorphisms and mRNA expression in rheumatoid arthritis patients from western Mexico.
Roman-Fernandez IV, et al.
Genetics and molecular research : GMR, 15(4) (2016)
Single nucleotide polymorphisms in the CD40 gene associate with the disease susceptibility and severity in knee osteoarthritis in the Chinese Han population: a case-control study
Deng ZH, et al.
BMC Musculoskelet. Disord., 18(1), 115-115 (2017)
Menno C van Zelm et al.
The Journal of allergy and clinical immunology, 134(1), 135-144 (2014-01-15)
Individuals with genetic defects in CD40 ligand (CD40L) or B-cell antigen receptor coreceptor molecules CD19 and CD81 suffer from an antibody deficiency. Still, these patients carry low levels of memory B cells and serum antibodies. We sought to assess why
Mala Upadhyay et al.
Journal of cellular physiology, 229(10), 1387-1396 (2014-02-01)
Immunological memory comprising of antigen-specific B and T cells contributes to the acquisition of long-term resistance to pathogens. Interactions between CD40 on B cells and CD40L on T cells are responsible for several aspects of acquired immune responses including generation
Bikui Zhang et al.
Neuroscience letters, 567, 6-10 (2014-03-25)
Post-stroke epilepsy (PSE) has a negative effect on stroke prognosis and quality of life. The CD40/CD40L system is reported to be involved in the progression of multiple disease states. We investigated the association between functional polymorphism of CD40 and PSE
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej