WH0010875M1
Monoclonal Anti-FGL2 antibody produced in mouse
clone 6D9, purified immunoglobulin, buffered aqueous solution
Sinônimo(s):
Anti-T49, Anti-fibrinogen-like 2, Anti-pT49
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Produtos recomendados
fonte biológica
mouse
conjugado
unconjugated
forma do anticorpo
purified immunoglobulin
tipo de produto de anticorpo
primary antibodies
clone
6D9, monoclonal
forma
buffered aqueous solution
reatividade de espécies
human, mouse, rat
técnica(s)
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
Isotipo
IgG2aκ
nº de adesão GenBank
nº de adesão UniProt
Condições de expedição
dry ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... FGL2(10875)
Descrição geral
Fibrinogen-like protein 2 (FGL2) belongs to the fibrinogen-like protein family. The FGL2 gene is located on the human chromosome at 7q11.23.
Imunogênio
FGL2 (NP_006673, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPG
Sequence
NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPG
Aplicação
Monoclonal Anti-FGL2 antibody produced in mouse has been used in immunohistochemistry.
Ações bioquímicas/fisiológicas
Fibrinogen-like protein 2 (FGL2) exhibits prothrombinase activity. It also shows immune regulatory activity during allograft rejection, abortion, and viral infections. This protein acts as an immune coagulant that produces thrombin directly. FGL2 through the clotting-dependent pathway may play a role in tumor angiogenesis and metastasis. It is involved in the pathogenesis of T helper type 1 (Th1) cytokine-induced fetal loss syndrome and viral-induced fulminant hepatitis. FGL2 gene is involved in modulating regulatory T cells (Treg) function. This protein regulates innate and adaptive immunity. FGL2 may serve as a therapeutic agent for glioblastoma (GBM) by promoting GBM progression.
forma física
Solution in phosphate buffered saline, pH 7.4
Informações legais
GenBank is a registered trademark of United States Department of Health and Human Services
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Equipamento de proteção individual
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Kai Su et al.
World journal of gastroenterology, 14(39), 5980-5989 (2008-10-22)
To examine the role of Fibrinogen-like protein 2 (fgl2)/fibroleukin in tumor development. Fgl2 has been reported to play a vital role in the pathogenesis in MHV-3 (mouse hepatitis virus) induced fulminant and severe hepatitis, spontaneous abortion, allo- and xeno- graft
Liang Shao et al.
Fundamental & clinical pharmacology, 28(1), 42-52 (2012-09-19)
Atorvastatin is not only an antilipemic but also used as an anti-inflammatory medicine in heart disease. Our working hypothesis was that atorvastatin preconditioning could improve the forward blood flow in the no-reflow rats associated with inflammation. We investigated that two
Yu Ding et al.
Chinese journal of integrative medicine, 27(7), 527-533 (2020-01-07)
To investigate the protective effects of Shexiang Tongxin Dropping Pill (, STDP) following sodium laurate-induced coronary microembolization (CME) in rats. Forty rats were divided into 4 groups: the control (sham) group, CME group, low-dose STDP pretreatment group (20 mg·kg-1·d-1), and
Khatri Latha et al.
Journal of the National Cancer Institute, 111(3), 292-300 (2018-06-28)
Virtually all low-grade gliomas (LGGs) will progress to high-grade gliomas (HGGs), including glioblastoma, the most common malignant primary brain tumor in adults. A key regulator of immunosuppression, fibrinogen-like protein 2 (FGL2), may play an important role in the malignant transformation
Itay Shalev et al.
Journal of immunology (Baltimore, Md. : 1950), 180(1), 249-260 (2007-12-22)
Mice with targeted deletion of fibrinogen-like protein 2 (fgl2) spontaneously developed autoimmune glomerulonephritis with increasing age, as did wild-type recipients reconstituted with fgl2-/- bone marrow. These data implicate FGL2 as an important immunoregulatory molecule and led us to identify the
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica